MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint du-2008a-1 Regulation of contractile vacuole formation and activity in Dictyostelium. dicdi Dictyostelium discoideum (Slime mold) Slime mold fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Du F., Edwards K., Shen Z., Sun B., De Lozanne A., Briggs S., Firtel RA. EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation du-2008a-2 Regulation of contractile vacuole formation and activity in Dictyostelium. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Du F., Edwards K., Shen Z., Sun B., De Lozanne A., Briggs S., Firtel RA. EMBO J. (0261-4189) 2008 2009-02-12 Only protein-protein interactions imex curation rb11a_dicdi Ras-related protein Rab-11A rab11A rab11 DDB_G0269238 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTSKGSQEEYDYLYKIVLIGDSGVGKSNLLSRFTRNEFSLETKSTIGVEFATRTIQTEGKTIKAQVWDTAGQERYRAITSAYYRGAVGALLVYDIAKQATYKSVERWILELRENADRNIEIMLVGNKSDLRHLREVSTDEAKEFSEKHKLTFIETSALDSSNVELAFQNILTQIYHIMSRPSHSTGPQTTIDSNTETIILPTTSEPPAAKSGCC Required for normal contractile vacuole structure and function. Cells expressing a dominant negative rab11A exhibit a more extensive contractile vacuole network and enlarged contractile vacuole bladders. These cells exhibit a functional defect in osmotic regulation where cells immersed in water become rounded and detach from the surface, and contain swollen contractile vacuoles mint q54iz7_dicdi DDB0187927 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MESSTEPNLPLKAESASIGISITDTCNTTNLTSNNNNNNNNNNNNNNNNNPNNNNNNNPNNNNNNNPNNNNNKNNPNNKNNNLIVDNIVDYNNLTVSPLPLNRSRSNSMNSGPTVHVISSTTGRGRSSSMSNNSMVINQPCGSTITTTNINSNTNNNSSSSSSSSNSYYNYFSRKSKNNKKIKVPSSPESIGGMGIMGGGIEGGDKYSFVLTASPSPNTYFNNNSVNNNLANFSLTDEGYLDTIAHENLKDPATLIRQREISSEWTSKIIPTNCTTDQARKNLKALIRKGIPDKKRNLVWKAIIGTNEADQTHCYNSAYSSSFGDESDPNIRNIPAFGGLFSPSDHLITEQGVKQVKSILNLIHTNSHVEYCPQISDLVHILISFMSEANTYTTTSLILKDAEENRPHRFLNIDKKECAKFVHSFDHLIELHLPKLHRHMITIGLTNSFVFSDEWFSRLFVSFLPYNTVLRIFDILLNEGYKVLYRIGLALLKTHKKQLKKQKDIEKFLSTLNKLNLQMFDADALIKVAFESISLKRSHLEDINDKQNHKVKDVPEPAPIYYRSKITIPSVILNSDDFELIWAWLPPRLSVATPRKLFNSVTDGNNVRLLFESLVEHTCILVVLKSDNGSIFGFYSDSEVQPKFGFGDRNVFLFTLKPHVHVYKPTEKNQLYTSFKEQSISIGHSNLGEIGLFIGADLNGKTGATETFGNPCLNDKDQHTFQTIVLEAFTIEQ mint rab8a_dicdi Ras-related protein Rab-8A rab8A sas1 sasA GTP-binding protein SAS1 DDB_G0280043 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MTSPATNKSAAYDYLIKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIGIDFKIRTIELEGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLVYDVTDEKSFGNIRNWIRNIEQHATDSVNKMLIGNKCDMAEKKVVDSSRGKSLADEYGIKFLETSAKNSINVEEAFISLAKDIKKRMIDTPNEQPQVVQPGTNLGANNNKKKACC mint Protein transport. Probably involved in vesicular traffic rb11c_dicdi Ras-related protein Rab-11C rab11C DDB_G0277101 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MPQEEEAEYLFKIVIIGDSAVGKSNLLNRFTRNEFTEKTKATIGVDFGTKSIEIDNKTITAQCWDTAGQERFRAVTSGYYRGAVGAMIVYDITSKISFKNVTRWLNELREMAEQDILIMMVGNKSDLEMSREVPTKEAQAFAESNKISFLETSALNSTNVNQSFERLLTDIYHLVSSKKPMVVDDTQNWLVPNQGKKLTPLSDPAPQLTANTTSTHQEKKSGCC mint tbc12_dicdi Drainin phgA DDB_G0269130 TBC1 domain family member 12 homolog protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MICFDNSTAHTDSNNNNNQCDLPENYKELVTTGKVEKLILSPSSSLDRPKTLPPKSQEEVLKHQREYEEIQRKAKKTLEREAKEKEKLDAIRKEKERSLIDARKVWEEDIIPVWEKNSKKRDIKKIKDLSWRGLPPAVRGKIWRLCIGNDLRVTDELFNIFLGHANNAYNKTTSPPLKSSLSSSSKSPNINIDLRQANNSIHHSRSPMNTSTDGEDDVLDLETTNMALILQDIQDTFPSLMIFQKGGPLHSDLIDVLGAYICYRPDIGYVPGMTFLAAMFLLNMEKCDAFLSLSNHINSVCFLPFFRQDQSGIPKYLAAMDSTVEALTPPLHKHFKEIGISAKNYLVDWITTLFSKALPLDVATRIWDLVFIEGEIFIYRTALSILRYFISDLIQATYDECIDLFNKLPQRKISEDKLFEEIQSIVLDQRKFDKLLEK May act as a GTPase-activating protein for Rab family protein(s) (By similarity). Required for osmotic regulation by the contractile vacuole in hypo-osmotic environments. Essential for periodic fusion of the contractile vacuole with the plasma membrane and consequent expulsion of water from the cell body mint rab14_dicdi Ras-related protein Rab-14 Rab4-like GTPase rab14 rab4 rabD DDB_G0281337 protein protein dicdi Dictyostelium discoideum (Slime mold) Slime mold MSFPYEYIFKYIIIGDMGVGKSCLLHQFTENKFVPDSPHTIGVEFGTRIVDVNNKKIKLQIWDTAGQERFRAVTRSYYRGAAGALLVYDITRRITYNHLTTWLTDARNLTNPNTVIMLIGNKKDLEGQRDVTYEEASAFAKQNGLIFVESSAKTGENVEEAFLRTAKLIFQSVQEGNVDLIPDGGITKNPPQTITDKPQDASKCSC Regulates the fusion of phagosomes and lysosomes mint q54iz7-rab11a 796055 rb11a_dicdi rab11A 796057 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q54iz7_dicdi disgorgin 796058 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5a mint q54iz7-rab8a 796055 rab8a_dicdi rab8A 796059 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q54iz7_dicdi disgorgin 796058 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5a mint q54iz7-rab11c 796055 q54iz7_dicdi disgorgin 796058 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rb11c_dicdi rab11c 796060 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5a mint phga-rab11a 796055 tbc12_dicdi Drainin 796061 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tagged gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rb11a_dicdi rab11A 796057 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5e mint rab14-phga 796056 rab14_dicdi rab14 796062 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tbc12_dicdi Drainin 796061 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b mint rab11a-phga 796056 tbc12_dicdi Drainin 796061 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rb11a_dicdi RAB11A 796057 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b mint rab11a-q54iz7 796056 rb11a_dicdi rab11A 796057 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q54iz7_dicdi disgorgin 796058 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b mint rab8a-q54iz7 796056 rab8a_dicdi rab8A 796059 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q54iz7_dicdi disgorgin 796058 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate v5 tagged v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f5b mint