IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ harrison-2008-1 ARL2, ARG1 and PIN3 define a gravity signal transduction pathway in root statocytes. arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Harrison BR., Masson PH. phmasson@wisc.edu Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation dnj39_arath Chaperone protein dnaJ 39 ATJ39 ARL2 C39 Protein ARG1-LIKE 2 T2K10.3 At1g59980 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATHSSRSENKDAGEEDELRRRNPYEVLGIPSNSTDQEIKSAYRRMALRYHPDKNPDDPVAAEMFKEVTFAYEVLSDPENRRLYDTTGSEAVGPENEDLELDLSSLGAVNTIFAALFNKLGVQIKTTVSANLLGEALNGTVTTLPLMVGQVVSRKVEKQSAHFYSVTLTEEEAQDGLICKVHSSAKNKFKLLYFDQVENGGLSLALQEDSRKTGKLSTAGLYFFGFPVYRFDHRVNSRALSRDPETGFFKRLDAFQPFEITELKAGSHVFAVYGDNFFKSVSYTLEIFSSAPFGNEKESLRSTEAQIVSKRTELLKFEAEYHEVFAQFTEMASKCTGEVQEIDELLKRRNEICAAYTIFPPTKQGSSKSRSWSKKKSSLLMEPREEGEVAVREEGGVKKKKWYNIQLRQDKKKN pin2_arath Auxin efflux carrier component 2 Auxin efflux carrier AGR Polar-auxin-transport efflux component AGR1 Protein AGRAVITROPIC 1 Ethylene-insensitive root 1 Protein WAVY 6 PIN2 AGR AGR1 EIR1 WAV6 MUL3.3 At5g57090 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MITGKDMYDVLAAMVPLYVAMILAYGSVRWWGIFTPDQCSGINRFVAVFAVPLLSFHFISSNDPYAMNYHFLAADSLQKVVILAALFLWQAFSRRGSLEWMITLFSLSTLPNTLVMGIPLLRAMYGDFSGNLMVQIVVLQSIIWYTLMLFLFEFRGAKLLISEQFPETAGSITSFRVDSDVISLNGREPLQTDAEIGDDGKLHVVVRRSSAASSMISSFNKSHGGGLNSSMITPRASNLTGVEIYSVQSSREPTPRASSFNQTDFYAMFNASKAPSPRHGYTNSYGGAGAGPGGDVYSLQSSKGVTPRTSNFDEEVMKTAKKAGRGGRSMSGELYNNNSVPSYPPPNPMFTGSTSGASGVKKKESGGGGSGGGVGVGGQNKEMNMFVWSSSASPVSEANAKNAMTRGSSTDVSTDPKVSIPPHDNLATKAMQNLIENMSPGRKGHVEMDQDGNNGGKSPYMGKKGSDVEDGGPGPRKQQMPPASVMTRLILIMVWRKLIRNPNTYSSLFGLAWSLVSFKWNIKMPTIMSGSISILSDAGLGMAMFSLGLFMALQPKIIACGKSVAGFAMAVRFLTGPAVIAATSIAIGIRGDLLHIAIVQAALPQGIVPFVFAKEYNVHPDILSTAVIFGMLVALPVTVLYYVLLGL arl2-pin2 853840 n/a 853841 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 853842 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 5a