IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ cot-2008-1 A multiprotein bicarbonate dehydration complex essential to carboxysome function in cyanobacteria. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cot SS., So AK., Espie GS. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species george.espie@utoronto.ca J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation cot-2008-2 A multiprotein bicarbonate dehydration complex essential to carboxysome function in cyanobacteria. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Cot SS., So AK., Espie GS. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species george.espie@utoronto.ca J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation cot-2008-3 A multiprotein bicarbonate dehydration complex essential to carboxysome function in cyanobacteria. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cot SS., So AK., Espie GS. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species george.espie@utoronto.ca J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation cot-2008-4 A multiprotein bicarbonate dehydration complex essential to carboxysome function in cyanobacteria. syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Cot SS., So AK., Espie GS. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Cell extracts separated on a Percol (silica particle) density gradient. george.espie@utoronto.ca J. Bacteriol. (0021-9193) 2008 Only protein-protein interactions imex curation ccmm_syny3 Carboxysome assembly protein CcmM ccmM Carbon dioxide concentrating mechanism protein CcmM sll1031 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MLAKSLGWLLAVSRRNYCMGSRTALASRPWSKHLADPQIDPTAYVHSFANVVGDVRIQPGVSVAPGSSIRADEGTPFWIGGNVLIQHGVVIHGLETGRVLGDDDQEYSVWIGPGTCVAHLALVHGPVYLGANCFIGFRSTVLNARVGDGAVVMMHSLVQDVEIPPNKLVPSGAMITQQHQADSLPDVQAGDRHFVQQIAAMHGQSASPTQGTDPTVCVLPESLPAVTPVTETPYINSIDNMSINSDITNQIRSLLAQGYGIGAEHANERRFKTKSWQSCGTADGFRPDQVIATVEGWLQEFAGEYVRLIGIDQGAKRRVVEVIIQRPGDVPGSPSRGTTTTKALSSGGSGRSAVAHQTGNLAGDSANQLRALLHQGYKIGLEYASARRFKTGSWLTGGTIGSHREGEALQELNRFLADHTNEYVRIIGIDPAGKRRVAEIVVHRPNGNGNGKPSSSSSSVGYKSAPVSSAGGSSAGGLTPEVIATVRGLLANGHSIGTEHTDKRRFKAKSWDTCPTIDGGREAEVLAKLEACLADHAGEYVRIIGIDRVGKRRVLEQIIQRPGDNVVAGRSPSSSSASTSSSASSNGFGSGNGGGYSNSAVRLDNSVVTQVRSLLAQGYKIGTEHTDKRRFKAKSWQSCAPITSTHESEVLRALEGCLADHNGEYVRLLGIDPTAKRRVLETIIQRP cynt_syny3 Carbonic anhydrase ccaA Carbonate dehydratase icfA slr1347 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MQRLIEGLQKFREGYFSSHRDLFEQLSHGQHPRILFICCSDSRVDPNLITQSEVGDLFVIRNAGNIIPPYGAANGGEGAAMEYALVALEINQIIVCGHSHCGAMKGLLKLNSLQEKLPLVYDWLKHTEATRRLVLDNYSHLEGEDLIEVAVAENILTQLKNLQTYPAIHSRLHRGDLSLHGWIYRIEEGEVLAYDGVLHDFVAPQSRINALEPEDEYAPHPNSPLISYDAFKVPGKERPGREKATESPAPQLSPLPGFGHLPREQAERIYRGSR 2F4F634246C0D5A9 ccmk1_syny3 Carboxysome shell protein CcmK1 ccmK1 Carbon dioxide-concentrating mechanism protein CcmK1 sll1029 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSIAVGMIETLGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVTAGIENIRRVNGGEVLSNHIIARPHENLEYVLPIRYTEAVEQFREIVNPSIIRR ccmk2_syny3 Carboxysome shell protein CcmK2 ccmK2 Carbon dioxide-concentrating mechanism protein CcmK2 sll1028 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSIAVGMIETRGFPAVVEAADSMVKAARVTLVGYEKIGSGRVTVIVRGDVSEVQASVSAGIEAANRVNGGEVLSTHIIARPHENLEYVLPIRYTEEVEQFRTY ccmk4_syny3 Carboxysome shell protein CcmK4 ccmK4 Carbon dioxide-concentrating mechanism protein CcmK4 slr1839 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MSAQSAVGSIETIGFPGILAAADAMVKAGRITIVGYIRAGSARFTLNIRGDVQEVKTAMAAGIDAINRTEGADVKTWVIIPRPHENVVAVLPIDFSPEVEPFREAAEGLNRR ccml_syny3 Carboxysome shell vertex protein CcmL ccmL Carbon dioxide concentrating mechanism protein CcmL sll1030 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MQLAKVLGTVVSTSKTPNLTGVKLLLVQFLDTKGQPLERYEVAGDVVGAGLNEWVLVARGSAARKERGNGDRPLDAMVVGIIDTVNVASGSLYNKRDDGR ccmn_syny3 Carboxysome assembly protein CcmN ccmN Carbon dioxide concentrating mechanism protein CcmN sll1032 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MQLPPVHSVSLSEYFVSGNVIIHETAVIAPGVILEAAPDCQITIEAGVCIGLGSVISAHAGDVKIQEQTAIAPGCLVIGPVTIGATACLGSRSTVFQQDIDAQVLIPPGSLLMNRVADVQTVGASSPTTDSVTEKKSPSTANPIAPIPSPWDNEPPAKGTDSPSDQAKESIARQSRPSTAEAAEQISSNRSPGESTPTAPTVVTTAPLVSEEVQEKPPVVGQVYINQLLLTLFPERRYFSS rbl_syny3 Ribulose bisphosphate carboxylase large chain cbbL rbcL slr0009 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MVQAKAGFKAGVQDYRLTYYTPDYTPKDTDLLACFRMTPQPGVPAEEAAAAVAAESSTGTWTTVWTDNLTDLDRYKGRCYDLEAVPNEDNQYFAFIAYPLDLFEEGSVTNVLTSLVGNVFGFKALRALRLEDIRFPVALIKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETNEMKGHYLNVTAGTCEEMMKRAEFAKEIGTPIIMHDFFTGGFTANTTLARWCRDNGILLHIHRAMHAVVDRQKNHGIHFRVLAKCLRLSGGDHLHSGTVVGKLEGERGITMGFVDLMREDYVEEDRSRGIFFTQDYASMPGTMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATANRVALEACVQARNEGRNLAREGNDVIREACRWSPELAAACELWKEIKFEFEAMDTL rbs_syny3 Ribulose bisphosphate carboxylase small subunit cbbS rbcS slr0012 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MKTLPKERRYETLSYLPPLTDQQIAKQVEFLLDQGFIPGVEFEEDPQPETHFWTMWKLPFFGGATANEVLAEVRECRSENPNCYIRVIGFDNIKQCQTVSFIVHKPNQNQGRY ifca-ccmm-1 Interaction between ifnA (ccaA) and ccmM demonstrated by Y2H 837035 n/a 837039 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 837040 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1B ifca-ccmm-2 Interaction between ifnA (ccaA) and ccmM demonstrated by Y2H 837035 n/a 837040 unspecified role unspecified role prey prey n/a 837039 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figs. 1B and 2 ccmm-ccmm-1 Homodimerisation of ccmM demonstrated by Y2H 837035 n/a 837039 unspecified role unspecified role bait bait n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 837039 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 837060 837058 physical association physical association false false false Fig. 1B ifca-ifca-1 Homodimerisation of ifnA (ccaA) demonstrated by Y2H 837035 n/a 837040 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 837040 unspecified role unspecified role bait bait physical association physical association false false false Figs. 1B and 2 ccmm-ccmk1-1 Interaction between ccmM and ccmK1 demonstrated by Y2H 837035 n/a 837039 unspecified role unspecified role bait bait n/a 837041 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B ccmm-ccmk2-1 Interaction between ccmM and ccmK2 demonstrated by Y2H 837035 n/a 837039 unspecified role unspecified role bait bait n/a 837042 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B ccmm-ccmk4-1 Interaction between ccmM and ccmK4 demonstrated by Y2H 837035 n/a 837039 unspecified role unspecified role bait bait n/a 837043 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B ccmm-ccml-1 Interaction between ccmM and ccmL demonstrated by Y2H 837035 n/a 837044 unspecified role unspecified role prey prey n/a 837039 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1B ccmm-ccmn-1 Interaction between ccmM and ccmN demonstrated by Y2H 837035 n/a 837039 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 837045 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B ifca-ccmm-4 Interaction between ifnA (ccaA), cbbL, and ccmM demonstrated by pulldown 837036 n/a 837040 unspecified role unspecified role prey prey n/a 837046 unspecified role unspecified role prey prey n/a 837039 unspecified role unspecified role prey prey syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) n/a 837040 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Tagged and non-tagged icfA differentiated by molecular weight. Fig. 4 ccmm-icfa-1 Interaction between ccmM and ICFA demonstrated by pulldown 837036 n/a 837040 unspecified role unspecified role prey prey syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) n/a 837039 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3, Fig. 4 ccmm-cbbl-1 Interaction between ccmM, cbbL and ccbbS demonstrated by pulldown 837036 n/a 837039 unspecified role unspecified role prey prey syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) n/a 837047 unspecified role unspecified role prey prey syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) n/a 837046 unspecified role unspecified role prey prey syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) n/a 837039 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) association association false false false Fig. 4 Tagged and untagged ccmM differentiated by molecular weight. ccmm-ccmn-2 Interaction between ccmM and ccmN demonstrated by coimmunoprecipitation 837037 n/a 837039 unspecified role unspecified role bait bait region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 837045 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 3 ccmm-cbbl-2 Interaction between ccmM, cbbL and icfa demonstrated by coimmunoprecipitation 837038 n/a 837040 unspecified role unspecified role neutral component neutral component n/a 837046 unspecified role unspecified role neutral component neutral component n/a 837039 unspecified role unspecified role neutral component neutral component physical association physical association false false false Fig. 5A, 5B Tagged and untagged ccmM differentiated by molecular weight.