MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint you-2006-1 Intracellular protein interaction mapping with FRET hybrids. ecoli Escherichia coli (strain K12) fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation you-2006-2 Intracellular protein interaction mapping with FRET hybrids. human Homo sapiens Human fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation you-2006-3 Intracellular protein interaction mapping with FRET hybrids. yeast Saccharomyces cerevisiae Baker's yeast fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation you-2006-4 Intracellular protein interaction mapping with FRET hybrids. in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined You X., Nguyen AW., Jabaiah A., Sheff MA., Thorn KS., Daugherty PS. SH3 Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2006 mimix curation mimix curation mona-2 MONA binding peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) ERPNRPAREFKFRCP mint grap2_mouse GRB2-related adaptor protein 2 GADS protein Growth factor receptor-binding protein GRBLG GRB-2-like protein Hematopoietic cell-associated adaptor protein GrpL GRB-2-related monocytic adapter protein Adapter protein GRID Grap2 Gads Grb2l Grid Mona protein protein mouse Mus musculus Mouse MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR mona-1 MONA binding peptide 1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) TSTPPLCPPRSAKAKVAKLGCFGG mint p2 PAPSIDRSTKPPL peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PAPSIDRSTKPPL mint mona-4 MONA binding peptide-4 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) STAPAVCRLSKRCVR mint mona-3 MONA binding peptide-3 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SAPARPPRTELPDLR mint mona-5 MONA binding peptide-5 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VAPPPTPLWLYRDLP mint mona-8 MONA binding peptide-8 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) LLVMGFRHILG mint mona-6 MONA binding peptide-6 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) YCRSNSAVPPPLPPK mint pdz2-2 LAAMGFSHSALNTSV peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) LAAMGFSHSALNTSV mint dlg4_human Disks large homolog 4 Postsynaptic density protein 95 Synapse-associated protein 90 DLG4 PSD95 protein protein human Homo sapiens Human MDCLCIVTTKKYRYQDEDTPPLEHSPAHLPNQANSPPVIVNTDTLEAPGYELQVNGTEGEMEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNEVDVREVTHSAAVEALKEAGSIVRLYVMRRKPPAEKVMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNSVGLEDVMHEDAVAALKNTYDVVYLKVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLSQALSFRFGDVLHVIDASDEEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRANDDLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLYGTSVQSVREVAEQGKHCILDVSANAVRRLQAAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIEDLSGPYIWVPARERL pdz2-4 PSD-95 binding peptide-4 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PSAPHVTAMRYWTSV mint pdz2-3 RSTVV peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) RSTVV mint pdz2-5 PSD-95 binding peptide-5 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) VVWWTVV mint pdz2-6 PSD-95 binding peptide-6 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SPTCLFESFPVWTMV mint pdz2-7 PSD-95 binding peptide-7 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SVPLGSAV mint pdz2-8 PSD-95 binding peptide-8 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SLTSEAQMSLRWTLV mint pdz2-9 PSD-95 binding peptide-9 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PSGFPVTLMSVSSLV mint pdz2-10 PSD-95 binding peptide-10 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) SYDLSSCSPPSWTL mint pdz2-1 PSD-95 binding peptide-1 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) PAISVNRPPSYSTPV mint nr2 IESDV peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) IESDV mint grap2-mona_2 814806 mona-2 MONA-2 814810 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 814806 t1 f3b domino mint grap2-mona_1 814806 mona-1 MONA-1 814812 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false domino mint FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction f3c t1 grap2-p2 814806 p2 P2 814813 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 814806 domino mint f2d f3a t1 f4a FACS (fluorescence-activated cell sorting) has been combined to FRET to detect the interaction grap2-mona_4 814806 mona-4 MONA-4 814814 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 814806 domino mint t1 grap2-mona_3 814806 mona-3 MONA-3 814815 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 814806 domino mint t1 grap2-mona_5 814806 mona-5 MONA-5 814816 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 814806 domino mint t1 grap2-mona_8 814806 mona-8 MONA-8 814817 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 814806 domino mint t1 grap2-mona_6 814806 mona-6 MONA-6 814818 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 domino mint t1 dlg4-pdz2_2 814806 pdz2-2 PDZ2-2 814819 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 domino mint t1 f3e dlg4-pdz2_4 814806 pdz2-4 PDZ2-4 814821 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 domino mint t1 f3f dlg4-pdz2_3 814806 pdz2-3 PDZ2-3 814822 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-pdz2_5 814806 pdz2-5 PDZ2-5 814823 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-pdz2_6 814806 pdz2-6 PDZ2-6 814824 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-pdz2_7 814806 pdz2-7 PDZ2-7 814825 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-pdz2_8 814806 pdz2-8 PDZ2-8 814826 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-pdz2_9 814806 pdz2-9 PDZ2-9 814827 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-pdz2_10 814806 pdz2-10 PDZ2-10 814828 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-pdz2_1-1 814806 pdz2-1 PDZ2-1 814829 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 t1 domino mint dlg4-nr2 814806 nr2 NR2 814830 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dlg4_human PSD-95 814820 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814806 domino mint t1 f3d grap2-p2-1 814807 p2 P2 814813 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F4C domino mint grap2-p2-2 814808 p2 P2 814813 unspecified role unspecified role fluorescence donor fluorescence donor fusion proteins fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F4B domino mint grap2-p2-3 814809 p2 P2 814813 unspecified role unspecified role fluorescence donor fluorescence donor tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false grap2_mouse MONA 814811 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yfp tagged yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 814809 f2a f2b domino mint