IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gissot-2006-1 AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr Plant Physiol. (0032-0889) 2006 Only protein-protein interactions imex curation gissot-2006-2 AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr Plant Physiol. (0032-0889) 2006 Only protein-protein interactions imex curation gissot-2006-3 AKINbetagamma contributes to SnRK1 heterotrimeric complexes and interacts with two proteins implicated in plant pathogen resistance through its KIS/GBD sequence. nicbe Nicotiana benthamiana bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Gissot L., Polge C., Jossier M., Girin T., Bouly JP., Kreis M., Thomas M. The authors state that the AKIN beta gamma "gene contains 13 exons and 12 introns encoding a 2.3-kb long cDNA corresponding to a protein of 487 amino acids " and that " the protein sequence deduced from the AKIN beta gamma I cDNA is reduced to 394 amino acids". However the annotated lengths of the proteins used in two hybrid studies consistently exceed these lengths, therefore because of this apparent inaccuracy it is not possible to curate information regarding regions of the AKIN beat gamma protein used in these experiments. Proteins were identified from references provided in the text or from gene name provided. martine.thomas@u-psud.fr Plant Physiol. (0032-0889) 2006 Only protein-protein interactions imex curation kin11_arath SNF1-related protein kinase catalytic subunit alpha KIN11 KIN11 AKIN alpha-1 AKIN11 SNF1-related kinase 1.2 SNR1 SNRK1.2 MXE2.16 At3g29160 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDHSSNRFGNNGVESILPNYKLGKTLGIGSFGKVKIAEHVVTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRQYEVIETTSDIYVVMEYVKSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSRCNIKIADFGLSNVMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSSEARDLIPRMLIVDPVKRITIPEIRQHRWFQTHLPRYLAVSPPDTVEQAKKINEEIVQEVVNMGFDRNQVLESLRNRTQNDATVTYYLLLDNRFRVPSGYLESEFQETTDSGSNPMRTPEAGASPVGHWIPAHVDHYGLGARSQVPVDRKWALGLQSHAHPREIMNEVLKALQELNVCWKKIGHYNMKCRWVPGLADGQNTMVNNQLHFRDESSIIEDDCAMTSPTVIKFELQLYKAREEKYLLDIQRVNGPQFLFLDLCAAFLTELRVI snf4_arath Sucrose nonfermenting 4-like protein CBS domain-containing protein CBSCBS3 SNF1-related protein kinase regulatory subunit betagamma F7G19.11 At1g09020 SNF4 CBSCBS3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MFGSTLDSSRGNSAASGQLLTPTRFVWPYGGRRVFLSGSFTRWTEHVPMSPLEGCPTVFQVICNLTPGYHQYKFFVDGEWRHDEHQPFVSGNGGVVNTIFITGPDMVPAGFSPETLGRSNMDVDDVFLRTADPSQEAVPRMSGVDLELSRHRISVLLSTRTAYELLPESGKVIALDVNLPVKQAFHILYEQGIPLAPLWDFGKGQFVGVLGPLDFILILRELGTHGSNLTEEELETHTIAAWKEGKAHISRQYDGSGRPYPRPLVQVGPYDNLKDVALKILQNKVAAVPVIYSSLQDGSYPQLLHLASLSGILKCICRYFRHSSSSLPILQQPICSIPLGTWVPRIGESSSKPLATLRPHASLGSALALLVQAEVSSIPVVDDNDSLIDIYSRSDITALAKDKAYAQIHLDDMTVHQALQLGQDASPPYGIFNGQRCHMCLRSDSLVKVMERLANPGVRRLVIVEAGSKRVEGIISLSDVFQFLLGL kin10_arath SNF1-related protein kinase catalytic subunit alpha KIN10 KIN10 AK21 SKIN10 SNR2 AKIN alpha-2 SNRK1.1 T4P13.22 At3g01090 AKIN10 SNF1-related kinase 1.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDGSGTGSRSGVESILPNYKLGRTLGIGSFGRVKIAEHALTGHKVAIKILNRRKIKNMEMEEKVRREIKILRLFMHPHIIRLYEVIETPTDIYLVMEYVNSGELFDYIVEKGRLQEDEARNFFQQIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNIMRDGHFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPGARDLIPRMLVVDPMKRVTIPEIRQHPWFQAHLPRYLAVPPPDTVQQAKKIDEEILQEVINMGFDRNHLIESLRNRTQNDGTVTYYLILDNRFRASSGYLGAEFQETMEGTPRMHPAESVASPVSHRLPGLMEYQGVGLRSQYPVERKWALGLQSRAHPREIMTEVLKALQDLNVCWKKIGHYNMKCRWVPNSSADGMLSNSMHDNNYFGDESSIIENEAAVKSPNVVKFEIQLYKTRDDKYLLDLQRVQGPQFLFLDLCAAFLAQLRVL kinb1_arath SNF1-related protein kinase regulatory subunit beta-1 KINB1 T10F18.200 At5g21170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNANGKDEDAAAGSGGADVTSSSARSNGGDPSARSRHRRPSSDSMSSSPPGSPARSPSPFLFAPQVPVAPLQRANAPPPNNIQWNQSQRVFDNPPEQGIPTIITWNQGGNDVAVEGSWDNWRSRKKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVHNFVPENPESIVEFEAPPSPDHSYGQTLPAAEDYAKEPLAVPPQLHLTLLGTTEETAIATKPQHVVLNHVFIEQGWTPQSIVALGLTHRFESKYITVVLYKPLTR kinb2_arath SNF1-related protein kinase regulatory subunit beta-2 KINB2 dl4210w FCAALL.163 At4g16360 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNVNAREEANSNNASAVEDEDAEICSREAMSAASDGNHVAPPELMGQSPPHSPRATQSPLMFAPQVPVLPLQRPDEIHIPNPSWMQSPSSLYEEASNEQGIPTMITWCHGGKEIAVEGSWDNWKTRSRLQRSGKDFTIMKVLPSGVYEYRFIVDGQWRHAPELPLARDDAGNTFNILDLQDYVPEDIQSISGFEPPQSPENSYSNLLLGAEDYSKEPPVVPPHLQMTLLNLPAANPDIPSPLPRPQHVILNHLYMQKGKSGPSVVALGSTHRFLAKYVTVVLYKSLQR kinb3_arath SNF1-related protein kinase regulatory subunit beta-3 F24D13.15 T1E2 At2g28060 KINB3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNSQNPDDHEDTTVVGFEVPVSPVSSYNNVYSSTEDETRDPPAVPPHLQHSLLGNQGSMELAYAPQNVVLNHLYIENRDAPRSVVALGFSHRFRTKFVTVVIYKPVQRRGSANV hspr1_arath Nematode resistance protein-like HSPRO1 HSPRO1 AKINbetagamma-interacting protein 1 Ortholog of sugar beet HS1 PRO-1 protein 1 Protein Hs1pro-1 F27K19.20 At3g55840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADLDLQRKMVSPKLHVTIPEPCKLSSVSSPISSSSSAACSAYELYLRLPELRNLWSSLYFPHWISEPVLKPALQALEITFRLILTVASDTRPYINRREWIRRLDSLTTSQIKIVAAICGDEDNYEENVSAAPVSNGWSSLSLLSEIATCRTSESVGQKILSTIENEMRWCKYTLGLGEPNLAGKPYLQYDAVCLPEELHSLKNNPYADHIENQENQMLYTSHQILESWIYVSVNLLYRIESRIEEGKFEKASSDVYLLERIWKLLSEIEDLHILMDPEDFLKVKKQLQIKSTFPNDAFCFRSKGLVEMAKMSKELRQKVPAVLEVEVDPTGGPRLQEAAMKLYSRKTEYEKIHLLQGMQAVESAAKRFFFGYQKLVAAMIGNAEANANRTVANHESYDSLTQVFMEPPYYPSLDAAKTFLGEFWSQL hspr2_arath Nematode resistance protein-like HSPRO2 At2g40000 HSPRO2 AKINbetagamma-interacting protein 2 Ortholog of sugar beet HS1 PRO-1 protein 2 Protein Hs1pro-2 T28M21.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVDMDWKRKMVSSDLPNSPKLSSKLHVTIPSPFKIVPVSSPISCSAPALCSAYELYLRLPELRKLWSSRDFPQWTSEPILKPALQALEISFRLVFAVCSDTRPYINHREWNRRLDSLITKQIQLVAAICEDEEEEGISAEAPVGGGRSSLSLLPQLATWRRSEALGKKILYTIDNEMSRCKYTLGLGEQNIAGKPNLRYDAICRPNEIYSLKDNPYADHIDNHENQTLYIIHQILESWIYASGNLLNRIVSSIEEEKFGKASNDVYLLEKIWKILAEIEDLHMLMDPEDFLKLKKQLQIKSTGKNDAFCFRSKGLVEMMKMSKDLRQKVPAVLAVEVDPTGGPRLQEAAMKLYARKTECDKIHLLQGMQAVEAAAKSFFFGYRQLVAAMMGSAEMNATASQESCDSLSQIFMEPTYFPSLDAAKTFLGEFWSHLG f4hzy9_arath Alkaline/neutral invertase CINV1 A N-InvG alkaline cytosolic invertase 1 neutral invertase G F15O4.33 At1g35580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGVGLRAVGSHCSLSEMDDLDLTRALDKPRLKIERKRSFDERSMSELSTGYSRHDGIHDSPRGRSVLDTPLSSARNSFEPHPMMAEAWEALRRSMVFFRGQPVGTLAAVDNTTDEVLNYDQVFVRDFVPSALAFLMNGEPDIVKHFLLKTLQLQGWEKRVDRFKLGEGVMPASFKVLHDPIRETDNIVADFGESAIGRVAPVDSGFWWIILLRAYTKSTGDLTLSETPECQKGMKLILSLCLAEGFDTFPTLLCADGCSMIDRRMGVYGYPIEIQALFFMALRSALSMLKPDGDGREVIERIVKRLHALSFHMRNYFWLDHQNLNDIYRFKTEEYSHTAVNKFNVMPDSIPEWVFDFMPLRGGYFVGNVGPAHMDFRWFALGNCVSILSSLATPDQSMAIMDLLEHRWAELVGEMPLKICYPCLEGHEWRIVTGCDPKNTRWSYHNGGSWPGLFSFPGD akin11-snf4 830061 n/a 830064 unspecified role unspecified role bait bait n/a 830065 unspecified role unspecified role prey prey physical association physical association false false false Figure 2A It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. akin10-snf4-1 830061 n/a 830066 unspecified role unspecified role bait bait n/a 830065 unspecified role unspecified role prey prey physical association physical association false false false Figure 2A It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. kinb1-snf4-1 830061 n/a 830067 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 830065 unspecified role unspecified role prey prey physical association physical association false false false Figure 3B It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. There is a slight difference between lengths of the bait protein in the text the length is given as 284 amino acids in the UniProt record this is 283 amino acids. kinb2-snf4-2 830061 n/a 830068 unspecified role unspecified role bait bait c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false n/a 830065 unspecified role unspecified role prey prey physical association physical association false false false Figure 3B It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. akin_beta3-snf4-3 830061 n/a 830069 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 830065 unspecified role unspecified role prey prey physical association physical association false false false Figure 3B It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. snf4-hspro1 830061 n/a 830070 unspecified role unspecified role prey prey n/a 830065 unspecified role unspecified role bait bait physical association physical association false false false Figure 7B It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. snf4-hspro2-1 830061 n/a 830065 unspecified role unspecified role bait bait n/a 830071 unspecified role unspecified role prey prey physical association physical association false false false Figure 7B It was not possible to curate information regarding regions of the prey protein as these appear to be poorly annotated. akin10-snf4-2 830062 n/a 830066 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 830065 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 2B kinb1-snf4-3 830062 n/a 830067 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 830065 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 3C kinb2-snf4-4 830062 n/a 830068 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 830065 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 3C hspro1-snf4-4 830062 n/a 830065 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 830072 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 7C hspro2-snf4-5 830062 n/a 830071 unspecified role unspecified role bait bait region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 830065 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 7C kinb2-snf4-3 830063 n/a 830065 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 830068 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3A akin_beta3-snf4-4 830063 n/a 830065 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 830069 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 3A snf4-hspro2 830063 n/a 830065 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 830071 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 7A snf4-hspro1-2 830063 n/a 830072 unspecified role unspecified role neutral component neutral component region C-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 830065 unspecified role unspecified role neutral component neutral component region N-terminal region of YFP protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 7A