MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint dimasi-2007-1 Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined only a selection of interactions described in this publication have been curated SH3 ndimasi@gmail.com Int. J. Biochem. Cell Biol. (1357-2725) 2007 partial coverage mimix curation mimix curation dimasi-2007-2 Crystal structure of the C-terminal SH3 domain of the adaptor protein GADS in complex with SLP-76 motif peptide reveals a unique SH3-SH3 interaction. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined only a selection of interactions described in this publication have been curated SH3 ndimasi@gmail.com Int. J. Biochem. Cell Biol. (1357-2725) 2007 partial coverage mimix curation mimix curation lcp2_human Lymphocyte cytosolic protein 2 LCP2 SH2 domain-containing leukocyte protein of 76 kDa SLP-76 tyrosine phosphoprotein protein protein human Homo sapiens Human MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP grap2_mouse GRB2-related adaptor protein 2 GADS protein Growth factor receptor-binding protein GRBLG GRB-2-like protein Hematopoietic cell-associated adaptor protein GrpL GRB-2-related monocytic adapter protein Adapter protein GRID Grap2 Gads Grb2l Grid Mona protein protein mouse Mus musculus Mouse MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGYVPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR grap2_human GRB2-related adapter protein 2 Protein GADS Growth factor receptor-binding protein GRBLG Grf40 adapter protein GRB-2-like protein GRBX P38 Hematopoietic cell-associated adapter protein GrpL Adapter protein GRID SH3-SH2-SH3 adapter Mona GRAP2 GADS GRB2L GRID protein protein human Homo sapiens Human MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR grap2-lcp2-1 813515 lcp2_human SLP76 813517 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false grap2_mouse GADS 813518 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint domino mint F1B F2 F3 F5 grap2-lcp2-2 813515 lcp2_human SLP76 813517 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.0 grap2_human GADS 813519 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.0 physical association physical association false false false f6 homomint domino mint grap2-lcp2-3 813516 lcp2_human SLP76 813517 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false grap2_mouse GADS 813518 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false F1A homomint domino mint