MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint march_s-2006-3 EspF of enteropathogenic Escherichia coli binds sorting nexin 9. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Marchès O., Batchelor M., Shaw RK., Patel A., Cummings N., Nagai T., Sasakawa C., Carlsson SR., Lundmark R., Cougoule C., Caron E., Knutton S., Connerton I., Frankel G. SH3 J. Bacteriol. (0021-9193) 2006 mimix curation mimix curation march_s-2006-1 EspF of enteropathogenic Escherichia coli binds sorting nexin 9. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Marchès O., Batchelor M., Shaw RK., Patel A., Cummings N., Nagai T., Sasakawa C., Carlsson SR., Lundmark R., Cougoule C., Caron E., Knutton S., Connerton I., Frankel G. SH3 J. Bacteriol. (0021-9193) 2006 mimix curation mimix curation march_s-2006-2 EspF of enteropathogenic Escherichia coli binds sorting nexin 9. in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Marchès O., Batchelor M., Shaw RK., Patel A., Cummings N., Nagai T., Sasakawa C., Carlsson SR., Lundmark R., Cougoule C., Caron E., Knutton S., Connerton I., Frankel G. SH3 J. Bacteriol. (0021-9193) 2006 mimix curation mimix curation b7um88_eco27 espF E2348C_3930 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MLNGISNAASTLGRQLVGIASRVSSAGGTGFSVAPQAVRLTPVRVHSPFSPGSSNVNARTIFNVSSQVTSFTPSRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYELSKASETVNFKPTRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYELSKASETVSFKPTRQAPPPPTSGQASGPGGLPPLAQALKDHLAAYEQSKKG snx9_human Sorting nexin-9 SNX9 SH3PX1 SH3PXD3A SH3 and PX domain-containing protein 1 SH3 and PX domain-containing protein 3A protein protein human Homo sapiens Human MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSCGNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNTPNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPGFAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLMECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM snx9-espf 822687 b7um88_eco27 EspF 822690 unspecified role unspecified role prey prey snx9_human 822691 unspecified role unspecified role bait bait physical association physical association false false false mint 3b espf-snx9-2 822687 b7um88_eco27 EspF 822690 unspecified role unspecified role bait bait snx9_human 822691 unspecified role unspecified role prey prey physical association physical association false false false mint 3b espf-snx9 822688 b7um88_eco27 EspF 822690 unspecified role unspecified role bait bait snx9_human 822691 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false domino mint 1a espf-snx9-1 822689 b7um88_eco27 EspF 822690 unspecified role unspecified role bait bait snx9_human 822691 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false domino mint 2c