MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint hoelz-2006-1 Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation hoelz-2006-4 Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. in vitro In vitro fcs fluorescence correlation spectroscopy FCS FCS fcs predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation hoelz-2006-2 Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation hoelz-2006-3 Crystal structure of the SH3 domain of betaPIX in complex with a high affinity peptide from PAK2. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Hoelz A., Janz JM., Lawrie SD., Corwin B., Lee A., Sakmar TP. SH3 hoelza@rockefeller.edu J. Mol. Biol. (0022-2836) 2006 mimix curation mimix curation pak2_human Serine/threonine-protein kinase PAK 2 p21-activated kinase 2 Gamma-PAK PAK65 S6/H4 kinase p58 PAK2 protein protein human Homo sapiens Human MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYLSFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSHVDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR arhg7_rat Rho guanine nucleotide exchange factor 7 Arhgef7 Pak3bp Pixb Beta-Pix PAK-interacting exchange factor beta protein protein rat Rattus norvegicus (Rat) Rat MTDNANSQLVVRAKFNFQQTNEDELSFSKGDVIHVTRVEEGGWWEGTHNGRTGWFPSNYVREIKPSEKPVSPKSGTLKSPPKGFDTTAINKSYYNVVLQNILETEHEYSKELQSVLSTYLWPLQTSEKLSSANTSYLMGNLEEISSFQQVLVQSLEECTKSPEAQQRVGGCFLSLMPQMRTLYLAYCANHPSAVSVLTEHSEDLGEFMETKGASSPGILVLTTGLSKPFMRLDKYPTLLKELERHMEDYHPDRQDIQKSMTAFKNLSAQCQEVRKRKELELQILTEPIRSWEGDDIKTLGSVTYMSQVTIQCAGSEEKNERYLLLFPNLLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEISGSMIERILVSCNNQQDLHEWVEHLQRQTKVTSVSNPTIKPHSVPSHTLPSHPLTPSSKHADSKPVALTPAYHTLPHPSHHGTPHTTISWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKEDLSRSPKTMKKLLPKRKPERKPSDEEFAVRKSTAALEEDAQILKVIEAYCTSAKTRQTLNSSSRKESAPQVLLPEEEKIIVEETKSNGQTVIEEKSLVDTVYALKDEVQELRQDNKKMKKSLEEEQRARKDLEKLVRKVLKNMNDPAWDETNL arhgef7-pak2 826863 pak2_human PAK 2 826867 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arhg7_rat Beta-Pix 826868 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 826863 homomint mint t2 f1c arhgef7-pak2-1 826863 arhg7_rat Beta-Pix 826868 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false pak2_human PAK 2 826867 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 826863 homomint mint t2 arhgef7-pak2-2 826863 pak2_human PAK 2 826867 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arhg7_rat Beta-Pix 826868 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 826863 homomint mint t2 arhgef7-pak2-5 826864 pak2_human PAK 2 826867 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arhg7_rat Beta-Pix 826868 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint t2 f1d arhgef7-pak2-6 826864 pak2_human PAK 2 826867 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arhg7_rat Beta-Pix 826868 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint t2 arhgef7-pak2-7 826864 pak2_human PAK 2 826867 unspecified role unspecified role prey prey binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false arhg7_rat Beta-Pix 826868 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint t2 arhgef7-pak2-3 826865 pak2_human PAK 2 826867 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.2 arhg7_rat Beta-Pix 826868 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 2.2 direct interaction direct interaction false false false homomint mint t1 f3a f3b f4a f4b f4c arhgef7-pak2-4 826866 pak2_human PAK 2 826867 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.1 arhg7_rat Beta-Pix 826868 unspecified role unspecified role neutral component neutral component binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 1.1 direct interaction direct interaction false false false homomint mint f1b