MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint satoh-2006-1 Rapid identification of 14-3-3-binding proteins by protein microarray analysis. in vitro In vitro peptide array peptide array predetermined predetermined participant predetermined Satoh J., Nanri Y., Yamamura T. only a selection of interactions described in this publication have been curated SH3 satoj@ncnp.go.jp J. Neurosci. Methods (0165-0270) 2006 partial coverage mimix curation mimix curation satoh-2006-2 Rapid identification of 14-3-3-binding proteins by protein microarray analysis. human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Satoh J., Nanri Y., Yamamura T. only a selection of interactions described in this publication have been curated SH3 satoj@ncnp.go.jp J. Neurosci. Methods (0165-0270) 2006 partial coverage mimix curation mimix curation 1433e_human 14-3-3 protein epsilon YWHAE protein protein human Homo sapiens Human MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ stac_human SH3 and cysteine-rich domain-containing protein STAC Src homology 3 and cysteine-rich domain-containing protein STAC1 protein protein human Homo sapiens Human MIPPSSPREDGVDGLPKEAVGAEQPPSPASTSSQESKLQKLKRSLSFKTKSLRSKSADNFFQRTNSEDMKLQAHMVAEISPSSSPLPAPGSLTSTPARAGLHPGGKAHAFQEYIFKKPTFCDVCNHMIVGTNAKHGLRCKACKMSIHHKCTDGLAPQRCMGKLPKGFRRYYSSPLLIHEQFGCIKEVMPIACGNKVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPGGGYDLRKRSNSVFTYPENGTDDFRDPAKNINHQGSLSKDPLQMNTYVALYKFVPQENEDLEMRPGDIITLLEDSNEDWWKGKIQDRIGFFPANFVQRLQQNEKIFRCVRTFIGCKEQGQITLKENQICVSSEEEQDGFIRVLSGKKKGLIPLDVLENI stac-ywhae 828034 1433e_human 14-3-3 protein epsilon 828036 unspecified role unspecified role prey prey stac_human STAC 828037 unspecified role unspecified role bait bait binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint t2 f1a f1f ywhae-stac 828035 1433e_human 14-3-3 protein epsilon 828036 unspecified role unspecified role bait bait stac_human STAC 828037 unspecified role unspecified role prey prey physical association physical association false false false f2a homomint mint