UniProt UniProt http://www.uniprot.org hofken-2004-2 Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Hofken T., Schiebel E. eschiebel@picr.man.ac.uk J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation hofken-2004-1 Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hofken T., Schiebel E. eschiebel@picr.man.ac.uk J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation hofken-2004-3 Novel regulation of mitotic exit by the Cdc42 effectors Gic1 and Gic2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hofken T., Schiebel E. eschiebel@picr.man.ac.uk J. Cell Biol. (0021-9525) 2004 Only protein-protein interactions imex curation gic1_yeast GTPase-interacting component 1 YHR061C GIC1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTEGKRLQQMELPQMKSIWIDEDQEMEKLYGFQVRQRFMNGPSTDSDEDADEDLGIVLVDSKKLALPNKNNIKLPPLPNYMTINPNINSNHKSLTNKKKNFLGMFKKKDLLSRRHGSAKTAKQSSISTPFDFHHISHANGKREDNPLESHEEKHDVESLVKFTSLAPQPRPDSNVSSKYSNVVMNDSSRIVSSSTIATTMDSHHDGNETNNTPNGNKQLDSPTDLEMTLEDLRNYTFPSVLGDSVSEKTNPSSPSVSSFSGKFKPRELSALHTPELGNCFNVDQSLNSPGNRISVDDVLKFYYQCSETSTPRNT cdc14_yeast Tyrosine-protein phosphatase CDC14 CDC14 OAF3 YFR028C protein protein yeast Saccharomyces cerevisiae Baker's yeast MRRSVYLDNTIEFLRGRVYLGAYDYTPEDTDELVFFTVEDAIFYNSFHLDFGPMNIGHLYRFAVIFHEILNDPENANKAVVFYSSASTRQRANAACMLCCYMILVQAWTPHQVLQPLAQVDPPFMPFRDAGYSNADFEITIQDVVYGVWRAKEKGLIDLHSFNLESYEKYEHVEFGDFNVLTPDFIAFASPQEDHPKGYLATKSSHLNQPFKSVLNFFANNNVQLVVRLNSHLYNKKHFEDIGIQHLDLIFEDGTCPDLSIVKNFVGAAETIIKRGGKIAVHCKAGLGRTGCLIGAHLIYTYGFTANECIGFLRFIRPGMVVGPQQHWLYLHQNDFREWKYTTRISLKPSEAIGGLYPLISLEEYRLQKKKLKDDKRVAQNNIEGELRDLTMTPPSNGHGALSARNSSQPSTANNGSNSFKSSAVPQTSPGQPRKGQNGSNTIEDINNNRNPTSHANRKVVIESNNSDDESMQDTNGTSNHYPKVSRKKNDISSASSSRMEDNEPSATNINNAADDTILRQLLPKNRRVTSGRRTTSAAGGIRKISGSIKK 4EB3985DFA3FD823 bfa1_yeast Mitotic check point protein BFA1 Cell cycle arrest protein BFA1 BFA1 YJR053W J1667 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSIRPLTLNGLDEPETSFEELNTTLPRFQSHETLTLEENVPPLSTSTYIPPPSSVGTSDTGTVFSNSTSAFWSNKQADDDQDMEVDQDDEFLNDFQEFQNKKDDFDDAIKTNFHLRNGCRTGPFKNDIFAEEFDRKLSLEDKPRLKQPRSMMELKPKRKLSNSVTSRNLRSGNSVRFKKSMPNLALVNPAIREEEEDEEREREDQREFNYKIDNDTQDTILAKFSSDDEGDFLTGFEELEGEAIDETISSNDKESADHPRFLKKSSSSLPLKISPAQYDIVKHDELLTPGLHRRQRDWNTQQELDSFKEKRSVRHCSNQNVQLNGPAKIKTIKQQIDHNTPMKKGSMIYNPKTMKWEGNENVLSKFSDVDTANRKALLIKNKLQRDADSKKQKYSDLQHARATSRNQKVIGNMILDEQNLRWVSVSEEEADPFAGIPEINLPPVGKSMKKRSSSPFLRSKSQVNTPFVSNDNDGVYQSTAAQARLRKYHSMRTLNGTTETPEISSTFHLSSRALEKFYHEENRWCKKLASWFIPRDETIISVDEETIMDESTVNSKRKSYMYEIRNMVINSTKD 1EA75D26FCF041DA bub2_yeast Mitotic check point protein BUB2 BUB2 YMR055C YM9796.08C Cell cycle arrest protein BUB2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MTSIEDLISNPPLLLHSSLSQLRYLILSEGLPISEDKQQQRTRCYVWTVLSQTSMEASTQRYLALLKLGPPSTTIYQKIKNDTSRTFQTDPNFRNRVSEDALIRCLSCFAWQTQQRRQKTRFGRIPVSTYVQGMNVLLAPLLYSCPSEPMAYQLFTKLCYEMIPTYLTKNLNGAQNGAKLLDISLRIIDPKLSKFLSDNLLTAEIYGMPSILTLSSCNKPLDQVIKLWDFMFAYGFHMNILFVVAFLVKMRSKVFKSDSPVNLLRQFPDFDADEIIRLGVGFIAKIPAQIYDLLVDHLTDPDIYIP A1DDBFB548E81EA3 tem1_yeast Protein TEM1 YML064C TEM1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MATPSTGANNSIPAVRNQVEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEWYRQAYGLNDSAIPILVGTKYDLLIDLDPEYQEQISRTSMKYAQVMNAPLIFCSTAKSINIQKIFKIALAKIFNLTLTIPEINEIGDPLLIYKHLGGQQHRHHNKSQDRKSHNIRKPSSSPSSKAPSPGVNT F650C8946A03707C net1_yeast Nucleolar protein NET1 YJL076W J1038 NET1 CFI1 ESC5 SRM8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MYKLQVVLVPPSLQATMPIQFGYGPTIAESSQLLPNRTNMAQSAGDASLQYANLRSANVSFTPSYFNQSRFRKFLLFTKPTNTLLNLSDEIIDKCEKMYPSLQEDIEILSLQDNSGCDLDPDFLVKDVFNVNNIVRVILKNEIDLDDSAPVSLYKSVKRSKLNNGSPQSVQPQQQIPSSSGVLRIAKKRPPTGTTTTTTIRSATNGSMRVSTPLARQIYPPPSSKIVSNNSDDEDEDIGERSFLPPPTQPQSPPIRISSGIDAGKKIKSSIVEEDIVSRSATVDPDKTKQQRLLSGTPIMSTMTPNRVTLTGQRVVSEHAHKNELVFSASASSSSFANGGTAAVTAQDINRKPPVTTPRITSGMLKIPEPRISEIEKELKEGPSSPASILPAKAAKIPMKKPYLENGENYESDDSSSSENQETPETEPHSKASLQRSQSSIADNNGSPVKNSPLGDAMPHNVHLAELPKASNTSITKSSNGESWGKQQEHQPPRKSSLETIVEKKSQAEPSGIVEPKRMTNFLDDNQVREKEDTNDKLLEKEILPTIPHNDQPILASSDKSNGTLKSLAGKVSSNNNASKEDGTIINGTIEDDGNDNDEVDTTVRIVPQDSDSSSFPKSDLFKMIEGDDTDLPQWFKGKNSRTSGNSKNSKPYTTVLNKDIDNSKPDPRNILPQRTPRSAAKRAAQLLAGAKKNEVPQKSTEDSSSAASTDDESESGIETDFSSDDDFKRKNMSVPNNGPKDISLHSLKGSVVPVKDSKIINKEVDEERNDKRDSQKKSAVSESSVTNSKISEQMAKSFYPNSNKKQNEATKVETKPATQASSFPVVGGSPSVATKGTTSFNEEGNRKNVKTKAKNESAQIDRQQKETTSRVADLKSANIGGEDLNKKAEGSKEPEKASANIQDANDKNNSKEKEDSKSKQVSQKKLKMTDHLKEGNVQLPKPSANDKLKDLKAKFTNSKTLVPPGIISNEKNNSSANDDDSSSSGSSTEDESSSSSSSSDEETSTSRKARRVVVNTPREPVRSSSKIEAPSPSVNKKINATPDKIPVTQLMDMSSPPSVKSKTTSNPSSILHDLPRKVRPSLSSLSDLVSRGIPDVKEKTSKSNEKSQTKAPSSSDDESSSDSDSNSSSDSVSDSSSDSKSESDSDDSGDSSDDGKSFISAKSASAALGKKKKPSGGFASLIKDFKKK 80EDF9A8065EB5A2 cdc42_yeast Cell division control protein 42 CDC42 SRO2 YLR229C L8083.13 Suppressor of RHO3 protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MQTLKCVVVGDGAVGKTCLLISYTTNQFPADYVPTVFDNYAVTVMIGDEPYTLGLFDTAGQEDYDRLRPLSYPSTDVFLVCFSVISPPSFENVKEKWFPEVHHHCPGVPCLVVGTQIDLRDDKVIIEKLQRQRLRPITSEQGSRLARELKAVKYVECSALTQRGLKNVFDEAIVAALEPPVIKKSKKCAIL 30BD644BA9836B2C gic1-cdc14-2 786638 n/a 786641 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786642 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig 3B, S1B Interaction is inhibited by NET1. gic1-bfa1-2 786638 n/a 786641 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786643 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig 3B gic1-bub2-2 786638 n/a 786644 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786641 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig 3B gic1-tem1-1 786638 n/a 786645 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786641 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig 3B bub2-tem1-1 786638 n/a 786645 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786644 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig 4A, 4G Interaction is inhibited by GST-GIC1. bfa1-tem1-1 786638 n/a 786645 unspecified role unspecified role prey prey n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786643 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction false false false Fig 4B Interaction is inhibited by GST-GIC1. bfa1-bub2-1 786638 n/a 786644 unspecified role unspecified role prey prey n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786643 unspecified role unspecified role bait bait n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig 4C Interaction is inhibited by GST-GIC1. net1-cdc14-1 786638 n/a 786642 unspecified role unspecified role prey prey n-terminus mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecobb Escherichia coli (strain B / BL21) n/a 786646 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false Fig S1B gic1-cdc42-1 786639 n/a 786647 unspecified role unspecified role prey prey n/a 786641 unspecified role unspecified role bait bait physical association physical association false false false Fig 3A gic1-bfa1-1 786639 n/a 786643 unspecified role unspecified role prey prey n/a 786641 unspecified role unspecified role bait bait physical association physical association false false false Fig 3A gic1-cdc14-1 786639 n/a 786642 unspecified role unspecified role prey prey n/a 786641 unspecified role unspecified role bait bait physical association physical association false false false Fig 3A bub2-gic1-1 786639 n/a 786641 unspecified role unspecified role prey prey n/a 786644 unspecified role unspecified role bait bait physical association physical association false false false Fig 3A bub2-tem1-2 786640 n/a 786645 unspecified role unspecified role bait bait c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 786644 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 4D Interaction is inhibited by GIC1.