MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint thompson-2003-2 Mapping eIF5A binding sites for Dys1 and Lia1: in vivo evidence for regulation of eIF5A hypusination. yeast Saccharomyces cerevisiae Baker's yeast pull down pull down predetermined predetermined participant predetermined Thompson GM., Cano VS., Valentini SR. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation thompson-2003-1 Mapping eIF5A binding sites for Dys1 and Lia1: in vivo evidence for regulation of eIF5A hypusination. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Thompson GM., Cano VS., Valentini SR. FEBS Lett. (0014-5793) 2003 Only protein-protein interactions imex curation if5a1_yeast Eukaryotic translation initiation factor 5A-1 Hypusine-containing protein HP2 TIF51A SYGP-ORF21 YEL034W HYP2 eIF-4D protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDEEHTFETADAGSSATYPMQCSALRKNGFVVIKSRPCKIVDMSTSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPVVKRNEYQLLDIDDGFLSLMNMDGDTKDDVKAPEGELGDSLQTAFDEGKDLMVTIISAMGEEAAISFKEAARTD 738F29CCC7820C47 dhys_yeast Deoxyhypusine synthase YHR068W DYS1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSDINEKLPELLQDAVLKASVPIPDDFVKVQGIDYSKPEATNMRATDLIEAMKTMGFQASSVGTACEIIDSMRSWRGKHIDELDDHEKKGCFDEEGYQKTTIFMGYTSNLISSGVRETLRYLVQHKMVDAVVTSAGGVEEDLIKCLAPTYLGEFALKGKSLRDQGMNRIGNLLVPNDNYCKFEEWIVPILDKMLEEQDEYVKKHGADCLEANQDVDSPIWTPSKMIDRFGKEINDESSVLYWAHKNKIPIFCPSLTDGSIGDMLFFHTFKASPKQLRVDIVGDIRKINSMSMAAYRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEYDGSDAGARPDEAVSWGKIKAEAKSVKLFADVTTVLPLIVAATFASGKPIKKVKN dohh_yeast Deoxyhypusine hydroxylase YJR070C J1814 Deoxyhypusine monooxygenase Ligand of eIF5A protein 1 Deoxyhypusine dioxygenase LIA1 MMD1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTNFEKHFQENVDECTLEQLRDILVNKSGKTVLANRFRALFNLKTVAEEFATKPEEAKKAIEYIAESFVNDKSELLKHEVAYVLGQTKNLDAAPTLRHVMLDQNQEPMVRHEAAEALGALGDKDSLDDLNKAAKEDPHVAVRETCELAINRINWTHGGAKDKENLQQSLYSSIDPAPPLPLEKDATIPELQALLNDPKQPLFQRYRAMFRLRDIGTDEAILALATGFSAESSLFKHEIAYVFGQIGSPAAVPSLIEVLGRKEEAPMVRHEAAEALGAIASPEVVDVLKSYLNDEVDVVRESCIVALDMYDYENSNELEYAPTAN AB36A73B40466CD5 hyp2-dys1-1 805316 if5a2_yeast eIF5A 805318 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dhys_yeast DYS1 805319 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F2A mint dys1-hyp2-1 805316 if5a2_yeast eIF5A 805318 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level dhys_yeast DYS1 805319 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2B mint lia1-hyp2 805316 if5a2_yeast eIF5A 805318 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level dohh_yeast LIA1 805320 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2C mint hyp2-dys1-2 805317 if5a2_yeast eIF5A 805318 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dhys_yeast DYS1 805319 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Thus, although the target site is located in the N-terminal domain, the modifying enzyme interacts with both domains of eIF5A. The truncation of eIF5A residues 1–42 or 1–63 weakens the interaction with Dys1 probably due to a conformational change in eIF5A structure, suggesting that the correct folding of the N-terminal domain of eIF5A is essential for efficient interaction with Dys1. mint F1 F3C hyp2-lia1 805317 if5a2_yeast eIF5A 805318 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dohh_yeast LIA1 805320 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint F1 F3C