IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gautschi-2003-3 The yeast N(alpha)-acetyltransferase NatA is quantitatively anchored to the ribosome and interacts with nascent polypeptides. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast crosslink cross-linking study crosslink autoradiography autoradiography Gautschi M., Just S., Mun A., Ross S., Rucknagel P., Dubaquie Y., Ehrenhofer-Murray A., Rospert S. Crosslinking reagent Bis(Sulfosuccinimidyl) suberate (BS3), performed with low-salt-treated ribosome-nascent chain complexes. Aliquots of the cross-link reactions were subjected to immunoprecipitation under denaturing conditions. Rospert@biochemie.uni-freiburg.de Sabine.Rospert@biochemie.uni-freiburg.de Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation gautschi-2003-1 The yeast N(alpha)-acetyltransferase NatA is quantitatively anchored to the ribosome and interacts with nascent polypeptides. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Gautschi M., Just S., Mun A., Ross S., Rucknagel P., Dubaquie Y., Ehrenhofer-Murray A., Rospert S. Rospert@biochemie.uni-freiburg.de Sabine.Rospert@biochemie.uni-freiburg.de Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation gautschi-2003-2 The yeast N(alpha)-acetyltransferase NatA is quantitatively anchored to the ribosome and interacts with nascent polypeptides. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Gautschi M., Just S., Mun A., Ross S., Rucknagel P., Dubaquie Y., Ehrenhofer-Murray A., Rospert S. Crosslinking agent was Bis(Sulfosuccinimidyl) suberate (BS3), reaction was performed in the presence of high-salt ribosome-nascent chain complexes. Rospert@biochemie.uni-freiburg.de Sabine.Rospert@biochemie.uni-freiburg.de Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation gautschi-2003-4 The yeast N(alpha)-acetyltransferase NatA is quantitatively anchored to the ribosome and interacts with nascent polypeptides. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Gautschi M., Just S., Mun A., Ross S., Rucknagel P., Dubaquie Y., Ehrenhofer-Murray A., Rospert S. Aliquots were separated on 10% Tris-Tricine gels. Ard1p and Nat5p were initially identified by N-terminal Edman degradation, Nat1p by mass spectrometry of a tryptic digest. Rospert@biochemie.uni-freiburg.de Sabine.Rospert@biochemie.uni-freiburg.de Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation gautschi-2003-5 The yeast N(alpha)-acetyltransferase NatA is quantitatively anchored to the ribosome and interacts with nascent polypeptides. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast crosslink cross-linking study crosslink weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Gautschi M., Just S., Mun A., Ross S., Rucknagel P., Dubaquie Y., Ehrenhofer-Murray A., Rospert S. Performed with low-salt treated RNCs carrying 35S-labeled prepro alpha 87 as a nascent chain. Aliquots of the cross-link reactions were subjected to immunoprecipitation under denaturing conditions. Rospert@biochemie.uni-freiburg.de Sabine.Rospert@biochemie.uni-freiburg.de Mol. Cell. Biol. (0270-7306) 2003 Only protein-protein interactions imex curation nat1_yeast N-terminal acetyltransferase A complex subunit NAT1 NAT1 AAA1 YDL040C D2720 Amino-terminal, alpha-amino, acetyltransferase 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRKRSTKPKPAAKIALKKENDQFLEALKLYEGKQYKKSLKLLDAILKKDGSHVDSLALKGLDLYSVGEKDDAASYVANAIRKIEGASASPICCHVLGIYMRNTKEYKESIKWFTAALNNGSTNKQIYRDLATLQSQIGDFKNALVSRKKYWEAFLGYRANWTSLAVAQDVNGERQQAINTLSQFEKLAEGKISDSEKYEHSECLMYKNDIMYKAASDNQDKLQNVLKHLNDIEPCVFDKFGLLERKATIYMKLGQLKDASIVYRTLIKRNPDNFKYYKLLEVSLGIQGDNKLKKALYGKLEQFYPRCEPPKFIPLTFLQDKEELSKKLREYVLPQLERGVPATFSNVKPLYQRRKSKVSPLLEKIVLDYLSGLDPTQDPIPFIWTNYYLSQHFLFLKDFPKAQEYIDAALDHTPTLVEFYILKARILKHLGLMDTAAGILEEGRQLDLQDRFINCKTVKYFLRANNIDKAVEVASLFTKNDDSVNGIKDLHLVEASWFIVEQAEAYYRLYLDRKKKLDDLASLKKEVESDKSEQIANDIKENQWLVRKYKGLALKRFNAIPKFYKQFEDDQLDFHSYCMRKGTPRAYLEMLEWGKALYTKPMYVRAMKEASKLYFQMHDDRLKRKSDSLDENSDEIQNNGQNSSSQKKKAKKEAAAMNKRKETEAKSVAAYPSDQDNDVFGEKLIETSTPMEDFATEFYNNYSMQVREDERDYILDFEFNYRIGKLALCFASLNKFAKRFGTTSGLFGSMAIVLLHATRNDTPFDPILKKVVTKSLEKEYSENFPLNEISNNSFDWLNFYQEKFGKNDINGLLFLYRYRDDVPIGSSNLKEMIISSLSPLEPHSQNEILQYYL DCFB870D049F91E6 rl4a_yeast 60S ribosomal protein L4-A RPL4A RPL2 RPL2A YBR031W YBR0315 L2 YL2 RP2 Large ribosomal subunit protein uL4-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFAPTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLVVSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQRRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWTEAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRPAGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKAEKTGTKPAAVFTETLKHD 37D0942A10AAE89F mdhm_yeast Malate dehydrogenase, mitochondrial YKL085W MDH1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSRVAKRAFSSTVANPYKVTVLGAGGGIGQPLSLLLKLNHKVTDLRLYDLKGAKGVATDLSHIPTNSVVKGFTPEEPDGLNNALKDTDMVLIPAGVPRKPGMTRDDLFAINASIVRDLAAATAESAPNAAILVISNPVNSTVPIVAQVLKNKGVYNPKKLFGVTTLDSIRAARFISEVENTDPTQERVNVIGGHSGITIIPLISQTNHKLMSDDKRHELIHRIQFGGDEVVKAKNGAGSATLSMAHAGAKFANAVLSGFKGERDVIEPSFVDSPLFKSEGIEFFASPVTLGPDGIEKIHPIGELSSEEEEMLQKCKETLKKNIEKGVNFVASK 8645C4CDFB9857C8 ssbp1_yeast Single-stranded nucleic acid-binding protein YHL034C SBP1 SSBR1 SSB1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAEIEEATNAVNNLSINDSEQQPRAPTHKTVIDPEDTIFIGNVAHECTEDDLKQLFVEEFGDEVSVEIPIKEHTDGHIPASKHALVKFPTKIDFDNIKENYDTKVVKDREIHIKRARTPGQMQRGGFRGRGGFRGRGGFRGGFRGGYRGGFRGRGNFRGRGGARGGFNGQKREKIPLDQMERSKDTLYINNVPFKATKEEVAEFFGTDADSISLPMRKMRDQHTGRIFTSDSANRGMAFVTFSGENVDIEAKAEEFKGKVFGDRELTVDVAVIRPENDEEEIEQETGSEEKQE FF740B206DDE5EC8 ard1_yeast N-terminal acetyltransferase A complex catalytic subunit ARD1 ARD1 Arrest-defective protein 1 YHR013C protein protein yeast Saccharomyces cerevisiae Baker's yeast MPINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQDENDKLELTLDGTNDGRTIKLDPTYLAPGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSVMRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSYYQDGEDAYAMKKVLKLEELQISNFTHRRLKENEEKLEDDLESDLLEDIIKQGVNDIIV AEB02BA5012D1137 nat5_yeast N-alpha-acetyltransferase NAT5 NAT5 YOR253W protein protein yeast Saccharomyces cerevisiae Baker's yeast MGRDICTLDNVYANNLGMLTKLAHVTVPNLYQDAFFSALFAEDSLVAKNKKPSSKKDVHFTQMAYYSEIPVGGLVAKLVPKKQNELSLKGIQIEFLGVLPNYRHKSIGSKLLKFAEDKCSECHQHNVFVYLPAVDDLTKQWFIAHGFEQVGETVNNFIKGVNGDEQDAILLKKHIS mfal1_yeast Mating factor alpha-1 YPL187W MF(ALPHA)1 MF-ALPHA-1 MFAL1 Alpha-1 mating pheromone protein protein yeast Saccharomyces cerevisiae Baker's yeast MRFPSIFTAVLFAASSALAAPVNTTTEDETAQIPAEAVIGYLDLEGDFDVAVLPFSNSTNNGLLFINTTIASIAAKEEGVSLDKREAEAWHWLQLKPGQPMYKREAEAEAWHWLQLKPGQPMYKREADAEAWHWLQLKPGQPMYKREADAEAWHWLQLKPGQPMY rpl4a-nat1-1 Interaction between Rpl4A(S2K) and Nat1 801354 n/a 801359 unspecified role unspecified role prey prey region cross linker cross linker crosslinker crosslinker undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 801360 unspecified role unspecified role bait bait P10664:p.Ser2Lys S2K mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast direct interaction direct interaction false false false Fig 4a mdh1-nat1 801354 n/a 801361 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 801359 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 4c mdh1-ssb1 801354 n/a 801362 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 801361 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 4c nat1-ard1-1 801355 n/a 801363 unspecified role unspecified role prey prey n/a 801364 unspecified role unspecified role prey prey n/a 801359 unspecified role unspecified role bait bait association association false false false Fig 2a ard1-nat1-3 801355 n/a 801359 unspecified role unspecified role prey prey n/a 801363 unspecified role unspecified role bait bait n/a 801364 unspecified role unspecified role prey prey association association false false false Fig 2a nat1-ard1-nat5 801356 n/a 801359 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 n/a 801363 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 n/a 801364 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 direct interaction direct interaction false false false Figure 1b nat1-nat5-ard1 801357 n/a 801364 unspecified role unspecified role neutral component neutral component n/a 801359 unspecified role unspecified role neutral component neutral component n/a 801363 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 2b nat1-mfal1 801358 n/a 801359 unspecified role unspecified role bait bait n/a 801365 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig 1c