UniProt UniProt http://www.uniprot.org yoshida-2003-2 Ras recruits mitotic exit regulator Lte1 to the bud cortex in budding yeast. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yoshida S., Ichihashi R., Toh-e A. toh-e@biol.s.u-tokyo.ac.jp J. Cell Biol. (0021-9525) 2003 Only protein-protein interactions imex curation yoshida-2003-1 Ras recruits mitotic exit regulator Lte1 to the bud cortex in budding yeast. ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Yoshida S., Ichihashi R., Toh-e A. toh-e@biol.s.u-tokyo.ac.jp J. Cell Biol. (0021-9525) 2003 Only protein-protein interactions imex curation yoshida-2003-3 Ras recruits mitotic exit regulator Lte1 to the bud cortex in budding yeast. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Yoshida S., Ichihashi R., Toh-e A. toh-e@biol.s.u-tokyo.ac.jp J. Cell Biol. (0021-9525) 2003 Only protein-protein interactions imex curation ras2_yeast Ras-like protein 2 RAS2 ASC1 CTN5 GLC5 YNL098C N2198 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPLNKSNIREYKLVVVGGGGVGKSALTIQLTQSHFVDEYDPTIEDSYRKQVVIDDEVSILDILDTAGQEEYSAMREQYMRNGEGFLLVYSITSKSSLDELMTYYQQILRVKDTDYVPIVVVGNKSDLENEKQVSYQDGLNMAKQMNAPFLETSAKQAINVEEAFYTLARLVRDEGGKYNKTLTENDNSKQTSQDTKGSGANSVPRNSGGHRKMSNAANGKNVNSSTTVVNARNASIESKTGLAGNQATNGKTQTDRTNIDNSTGQAGQANAQSANTVNNRVNNNSKAGQVSNAKQARKQQAAPGGNTSEASKSGSGGCCIIS 6CAAAC531EEAE92F lte1_yeast Guanine nucleotide exchange factor LTE1 LTE1 MSI2 YAL024C EIS4 Low temperature essential protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MEIFSQKDYYPTPSSNVISYESDCVSKPVNSADLPALIVHLSSPLEGVDYNASADFFLIYRNFITPQDLHDLLIYRFRWCIREITTNAAKAKRRRIGEVALVRTFVLLRHSILNYFVQDFLPNITLRLRLIEFLNDKHIEQYPKIISSCIINLKKNWVHCSKLVWENIELNEPDKLDFDAWLHYSLKDFTQLESLHKRGSRLSIYARQSFASPDFRNQSVLSLYKTSDVFRLPEKLQSSNSSKNQRSPSMLLFPDNTSNVYSKHRIAKEPSVDNESEDMSDSKQKISHLSKVTLVSTLMKGVDYPSSYAVDKIMPPTPAKKVEFILNSLYIPEDLNEQSGTLQGTSTTSSLDNNSNSNSRSNTSSMSVLHRSAIGLLAKWMKNHNRHDSSNDKKFMSAIKPANQKPEMDAFVKYVVSISSLNRKSSKEEEEEFLNSDSSKFDILSARTIDEVESLLHLQNQLIEKVQTHSNNNRGPTVNVDCERREHIHDIKILQQNSFKPSNDNFSAMDNLDLYQTVSSIAQSVISLTNTLNKQLQNNESNMQPSPSYDALQRRKVKSLTTAYYNKMHGSYSAESMRLFDKDNSSSRTDENGPQRLLFHETDKTNSEAITNMTPRRKNHSQSQKSMTSSPLKNVLPDLKESSPLNDSREDTESITYSYDSELSSSSPPRDTVTKKSRKVRNIVNNTDSPTLKTKTGFLNLREFTFEDTKSLDEKKSTIDGLEKNYDNKENQESEYESTKKLDNSLDASSEANNYDITTRKKHSSCNHKIKQAVVRPASGRISISRVQSIAITPTKELSIVDPEQNKSNSVIEEISEIEPLNLEYNKKSALYSDTSSTVISISTSKLFESAQNSPLKQTQNPQREFPNGTSVSETNRIRLSIAPTIESVVSDLNSITTGSTVETFETSRDLPVPHQRIINLREEYQRGNQDIISNTSSLHELKTIDLSDSNNDLESPSTHAKNNKYFFSPDDGSIDVASPMKNVEELKSKFLKNESETNSNISGSVLTMDDIDINDTSSARNTRRANSESAFTGSLNKKNLNEIANMLDDSINDDPITVALMKLEGTYEKIPEKPENTKSSDAIGIKTSKLADEVEMLNLNNLPSFQNSPAEKRKSLLIERRRQTIMNIPFTPDQSEKEGFTSSSPEKIDVSANVDVAVQAAQIQELIGQYRIHDSRLMISNNESHVPFILMYDSLSVAQQMTLIEKEILGEIDWKDLLDLKMKHEGPQVISWLQLLVRNETLSGIDLAISRFNLTVDWIISEILLTKSSKMKRNVIQRFIHVADHCRTFQNFNTLMEIILALSSSVVQKFTDAWRLIEPGDLLTWEELKKIPSLDRNYSTIRNLLNSVNPLVGCVPFIVVYLSDLSANAEKKDWILEDKVVNYNKFDTNVQIVKNFIQRVQWSKFYTFKVNHELLSKCVYISTLTQEEINELST EED7E5150BECA3DE lte1-ras2-1 787525 n/a 787528 unspecified role unspecified role prey prey P01120:p.Cys318Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n/a 787529 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Fig 1B, 5B When LTE1 is expressed at a low level, the Gly-19-Val mutation in RAS2 does not affect binding. lte1-ras2-2 787525 n/a 787529 unspecified role unspecified role bait bait c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 787528 unspecified role unspecified role prey prey P01120:p.Gly22Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P01120:p.Gly19Val mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P01120:p.Cys318Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 1C ras2-lte1-2 787525 n/a 787529 unspecified role unspecified role prey prey c-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 787528 unspecified role unspecified role bait bait n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 4A, 4B ras2-lte1-1 787526 n/a 787529 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 787528 unspecified role unspecified role bait bait P01120:p.Gly19Val mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig 1A lte1-ras2-3 787527 n/a 787528 unspecified role unspecified role prey prey spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection n/a 787529 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Fig 1E Binding is stimulated by GTP.