IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhu-2002-2 Six3-mediated auto repression and eye development requires its interaction with members of the Groucho-related family of co-repressors. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhu CC., Dyer MA., Uchikawa M., Kondoh H., Lagutin OV., Oliver G. guillermo.oliver@stjude.org E10.5 mouse cDNA Development (0950-1991) 2002 Only protein-protein interactions imex curation zhu-2002-3 Six3-mediated auto repression and eye development requires its interaction with members of the Groucho-related family of co-repressors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zhu CC., Dyer MA., Uchikawa M., Kondoh H., Lagutin OV., Oliver G. guillermo.oliver@stjude.org E10.5 mouse cDNA Development (0950-1991) 2002 Only protein-protein interactions imex curation zhu-2002-1 Six3-mediated auto repression and eye development requires its interaction with members of the Groucho-related family of co-repressors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zhu CC., Dyer MA., Uchikawa M., Kondoh H., Lagutin OV., Oliver G. guillermo.oliver@stjude.org E10.5 mouse cDNA Development (0950-1991) 2002 Only protein-protein interactions imex curation zhu-2002-4 Six3-mediated auto repression and eye development requires its interaction with members of the Groucho-related family of co-repressors. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells confocal microscopy confocal microscopy immunostaining immunostaining Zhu CC., Dyer MA., Uchikawa M., Kondoh H., Lagutin OV., Oliver G. guillermo.oliver@stjude.org E10.5 mouse cDNA Development (0950-1991) 2002 Only protein-protein interactions imex curation zhu-2002-5 Six3-mediated auto repression and eye development requires its interaction with members of the Groucho-related family of co-repressors. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhu CC., Dyer MA., Uchikawa M., Kondoh H., Lagutin OV., Oliver G. guillermo.oliver@stjude.org E10.5 mouse cDNA Development (0950-1991) 2002 Only protein-protein interactions imex curation zhu-2002-6 Six3-mediated auto repression and eye development requires its interaction with members of the Groucho-related family of co-repressors. mouse-3t3 Mus musculus embryo cells 3t3 Mouse embryo fibroblast cells anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Zhu CC., Dyer MA., Uchikawa M., Kondoh H., Lagutin OV., Oliver G. guillermo.oliver@stjude.org E10.5 mouse cDNA Development (0950-1991) 2002 Only protein-protein interactions imex curation six3_mouse Homeobox protein SIX3 Six3 Sine oculis homeobox homolog 3 protein protein mouse Mus musculus Mouse MVFRSPLDLYSSHFLLPNFADSHHCSLLLASSGGGSGASGGGGGAGGGGGGNRAGGGGAGGAGGGSGGGGSRAPPEELSMFQLPTLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDSECDV tle5_mouse TLE family member 5 Tle5 Aes Amino-terminal enhancer of split Esp1 Grg Grg-5 Grg5 Groucho-related protein 5 Protein ESP1 Protein GRG protein protein mouse Mus musculus Mouse MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQTHLSKEDKNGHDGDTHQEDDGEKSD six6_mouse Homeobox protein SIX6 Six6 Optx2 Six9 Sine oculis homeobox homolog 6 Optic homeobox 2 Six9 protein protein protein mouse Mus musculus Mouse MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGPGRVLRSEGEGTPEVLGVASSPAASLSSKAATSAISITSSDSECDI so_drome Protein sine oculis so CG11121 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MLQHPATDFYDLAAANAAAVLTARHTPPYSPTGLSGSVALHNNNNNNSSTSNNNNSTLDIMAHNGGGAGGGLHLNSSSNGGGGGGVVSGGGSGGRENLPSFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKDGSTDKQHLDSSSDSEMEGSMLPSQSAQHQQQQQQQQHSPGNSSGNNNGLHQQQLQHVAAEQGLQHHPHQPHPASNIANVAATKSSGGGGGGGVSAAAAAQMQMPPLTAAVAYSHLHSVMGAMPMTAMYDMGEYQHL tle4_mouse Transducin-like enhancer protein 4 Tle4 Grg4 Groucho-related protein 4 Grg-4 protein protein mouse Mus musculus Mouse MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIPFLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSHGHGLPVPLTPHPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRDRDSIKSSSVSPSASFRGSEKHRNSTDYSSESKKQKTEEKEIAARYDSDGEKSDDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASVASSSSTPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKPPGVDPLASSLRTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNISPQMSAAAAAAAAAAAYGRSPVVGFDPHHHMRVPAIPPNLTGIPGGKPAYSFHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLHESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY optix_drome Protein Optix Optix opt Six3 Homeobox protein SIX3 CG18455 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MAVGPTEGKQPPSESFSPTHHQIIAPSPILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNRIQHSQNSSGMGCRSRRADGAASPTPSDSSDSDISLGTHSPVPSSLQLQHSPGSTSNGANDREESLSVDDDKPRDLSGSLPLPLSLPLPLASPTHTPPQLPPGYGGGAGAGPGGPLTGPGCLPPFKLDAATSLFSAGCYLQSFSNLKEMSQQFPIQPIVLRPHPQLPQSLALNGASGGPPLHHPAYAAAYSVECVPGGHGPPHPPPKLRINSPEKLNSTAVAAAASVGGGGGNQHHEPTTTGYHHSGQLMLHRPFSTSPELKHSAPEIT grou_drome Protein groucho gro E(spl)m9/m10 CG8384 Enhancer of split m9/10 protein protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MYPSPVRHPAAGGPPPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLSNEKTEMQRHYVMYYEMSYGLNVEMHKQTEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIGHQQQHGIQQLLQQIHAQQVPGGPPQPMGALNPFGALGATMGLPHGPQGLLNKPPEHHRPDIKPTGLEGPAAAEERLRNSVSPADREKYRTRSPLDIENDSKRRKDEKLQEDEGEKSDQDLVVDVANEMESHSPRPNGEHVSMEVRDRESLNGERLEKPSSSGIKQERPPSRSGSSSSRSTPSLKTKDMEKPGTPGAKARTPTPNAAAPAPGVNPKQMMPQGPPPAGYPGAPYQRPADPYQRPPSDPAYGRPPPMPYDPHAHVRTNGIPHPSALTGGKPAYSFHMNGEGSLQPVPFPPDALVGVGIPRHARQINTLSHGEVVCAVTISNPTKYVYTGGKGCVKVWDISQPGNKNPVSQLDCLQRDNYIRSVKLLPDGRTLIVGGEASNLSIWDLASPTPRIKAELTSAAPACYALAISPDSKVCFSCCSDGNIAVWDLHNEILVRQFQGHTDGASCIDISPDGSRLWTGGLDNTVRSWDLREGRQLQQHDFSSQIFSLGYCPTGDWLAVGMENSHVEVLHASKPDKYQLHLHESCVLSLRFAACGKWFVSTGKDNLLNAWRTPYGASIFQSKETSSVLSCDISTDDKYIVTGSGDKKATVYEVIY grg5-six3 803693 n/a 803699 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 803700 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 grg5-six6 803693 n/a 803700 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 803701 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false deacetylation deacetylation reaction deacetylation false false false 2 grg5-so 803693 n/a 803700 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 803702 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false 2 grg4-six3 803693 n/a 803699 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q62233:p.Phe88Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 803703 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 grg4-six6 803693 n/a 803703 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 803701 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 2 grg4-optix 803693 n/a 803704 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 803703 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 six3-groucho 803693 n/a 803705 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 803699 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2 six3-grg5-1 803694 n/a 803700 unspecified role unspecified role prey prey n/a 803699 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3A grg5-six3-1 803694 n/a 803699 unspecified role unspecified role bait bait n/a 803700 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 3B six3-grg5 803695 n/a 803699 unspecified role unspecified role bait bait n/a 803700 unspecified role unspecified role prey prey physical association physical association false false false grg5-six3-2 803696 n/a 803699 unspecified role unspecified role neutral component neutral component n/a 803700 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 4B six3-grg4 803697 n/a 803699 unspecified role unspecified role prey prey n/a 803703 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2C six3-groucho-1 803698 n/a 803699 unspecified role unspecified role bait bait n/a 803705 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2D