IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ kosugi-2002-1 Interaction of the Arabidopsis E2F and DP proteins confers their concomitant nuclear translocation and transactivation. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Kosugi S., Ohashi Y. yohashi@nias.affrc.go.jp Plant Physiol. (0032-0889) 2002 Only protein-protein interactions imex curation kosugi-2002-2 Interaction of the Arabidopsis E2F and DP proteins confers their concomitant nuclear translocation and transactivation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kosugi S., Ohashi Y. yohashi@nias.affrc.go.jp Plant Physiol. (0032-0889) 2002 Only protein-protein interactions imex curation e2fb_arath Transcription factor E2FB At5g22220 E2FB E2F1 E2F transcription factor-1 T6G21 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSEEVPQQFPSSKRQLHPSLSSMKPPLVAPGEYHRFDAAETRGGGAVADQVVSDAIVIKSTLKRKTDLVNQIVEVNELNTGVLQTPVSGKGGKAKKTSRSAKSNKSGTLASGSNAGSPGNNFAQAGTCRYDSSLGLLTKKFINLIKQAEDGILDLNKAADTLEVQKRRIYDITNVLEGIGLIEKTLKNRIQWKGLDVSKPGETIESIANLQDEVQNLAAEEARLDDQIRESQERLTSLSEDENNKRLLFVTENDIKNLPCFQNKTLIAVKAPHGTTLEVPDPDEAGGYQRRYRIILRSTMGPIDVYLVSQFEESFEDIPQADEPSNVPDEPSNVPDVPSNLPSTSGLPENHDVSMPMKEESTERNMETQEVDDTQRVYSDIESHDFVDGIMKIVPPDLDMGVDYWFRSEVGEVSITDMWPDESGPDWNQMITFDQDHAGPSDNKILEQPQTPSSPTPEESTATRSPTGS dpa_arath Transcription factor-like protein DPA DPA DP2A DP-like protein A At5g02470 E2F dimerization partner protein A T22P11.60 DP2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSMEMELFVTPEKQRQHPSVSVEKTPVRRKLIVDDDSEIGSEKKGQSRTSGGGLRQFSVMVCQKLEAKKITTYKEVADEIISDFATIKQNAEKPLNENEYNEKNIRRRVYDALNVFMALDIIARDKKEIRWKGLPITCKKDVEEVKMDRNKVMSSVQKKAAFLKELREKVSSLESLMSRNQEMVVKTQGPAEGFTLPFILLETNPHAVVEIEISEDMQLVHLDFNSTPFSVHDDAYILKLMQEQKQEQNRVSSSSSTHHQSQHSSAHSSSSSCIASGTSGPVCWNSGSIDTR pcna_tobac_gene Nicotiana tabacum gene for proliferating cell nuclear antigen, promoter region gene gene tobac Nicotiana tabacum (Common tobacco) Common tobacco dpb_arath Transcription factor-like protein DPB DPB At5g03415 DP-like protein B E2F dimerization partner protein B F12E4.160 DP1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTTGSNSNHNHHESNNNNNNPSTRSWGTAVSGQSVSTSGSMGSPSSRSEQTITVVTSTSDTTFQRLNNLDIQGDDAGSQGASGVKKKKRGQRAAGPDKTGRGLRQFSMKVCEKVESKGRTTYNEVADELVAEFALPNNDGTSPDQQQYDEKNIRRRVYDALNVLMAMDIISKDKKEIQWRGLPRTSLSDIEELKNERLSLRNRIEKKTAYSQELEEQYVGLQNLIQRNEHLYSSGNAPSGGVALPFILVQTRPHATVEVEISEDMQLVHFDFNSTPFELHDDNFVLKTMKFCDQPPQQPNGRNNSQLVCHNFTPENPNKGPSTGPTPQLDMYETHLQSQQHQQHSQLQIIPMPETNNVTSSADTAPVKSPSLPGIMNSSMKPEN e2fc_arath Transcription factor E2FC E2FC At1g47870 E2F2 E2F transcription factor-2 T2E6.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAATSNSGEDPTLSYHHRSPFRFELLQSISSSDPRYSSLTPSSTNRPFSVSQSLPNSQLSPLISPHWDDSYSQITQKVQKSRKNHRIQLGSIANMSGGESIDIAKVIVKQESSPQNVKRVYNKSKGGTKLLKAGKRMANGEVQNGGLNGASINCRYDSSLGLLTKKFVKLIQEAEDGTLDLNYCAVVLEVQKRRIYDITNVLEGIGLIEKTTKNHIRWKGADNLGQKDLGDQISRLKSEVESMQSEESRLDDLIRERQEALRSLEEDDYCRRYMFMTEEDITSLPRFQNQTLLAIKAPTASYIEVPDPDEMSFPQQYRMVIRSRMGPIDVYLLSKYKGDSAETSDKLGNESDQKAPVGVDTPSLKIVTSDTDLKADYWFESDAEVSLTDLWSNFNS e2fa_arath Transcription factor E2FA E2FA At2g36010 E2F3 E2F4 E2F transcription factor-3 F11F19.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSGVVRSSPGSSQPPPPPPHHPPSSPVPVTSTPVIPPIRRHLAFASTKPPFHPSDDYHRFNPSSLSNNNDRSFVHGCGVVDREEDAVVVRSPSRKRKATMDMVVAPSNNGFTSSGFTNIPSSPCQTPRKGGRVNIKSKAKGNKSTPQTPISTNAGSPITLTPSGSCRYDSSLGLLTKKFVNLIKQAKDGMLDLNKAAETLEVQKRRIYDITNVLEGIDLIEKPFKNRILWKGVDACPGDEDADVSVLQLQAEIENLALEEQALDNQIRQTEERLRDLSENEKNQKWLFVTEEDIKSLPGFQNQTLIAVKAPHGTTLEVPDPDEAADHPQRRYRIILRSTMGPIDVYLVSEFEGKFEDTNGSGAAPPACLPIASSSGSTGHHDIEALTVDNPETAIVSHDHPHPQPGDTSDLNYLQEQVGGMLKITPSDVENDESDYWLLSNAEISMTDIWKTDSGIDWDYGIADVSTPPPGMGEIAPTAVDSTPR ef1-dpa-dna 828343 n/a 828345 unspecified role unspecified role prey prey in vitro In vitro n/a 828346 unspecified role unspecified role prey prey in vitro In vitro n/a 828347 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 ef1-dpb-dna 828343 n/a 828345 unspecified role unspecified role prey prey in vitro In vitro n/a 828347 unspecified role unspecified role bait bait n/a 828348 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Figure 1 ef2-dpa-dna 828343 n/a 828347 unspecified role unspecified role bait bait n/a 828346 unspecified role unspecified role prey prey in vitro In vitro n/a 828349 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Figure 1 ef2-dpb-dna 828343 n/a 828347 unspecified role unspecified role bait bait n/a 828348 unspecified role unspecified role prey prey in vitro In vitro n/a 828349 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Figure 1 ef3-dpa-dna 828343 n/a 828350 unspecified role unspecified role prey prey in vitro In vitro n/a 828347 unspecified role unspecified role bait bait n/a 828346 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false Figure 1 ef3-dpb-dna 828343 n/a 828350 unspecified role unspecified role prey prey in vitro In vitro n/a 828348 unspecified role unspecified role prey prey in vitro In vitro n/a 828347 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 ef2-dpb 828344 n/a 828348 unspecified role unspecified role bait bait n/a 828349 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 The authors concluded that "the yeast assay revealed a differential specificity in the dimerization affinity. AtE2F1 and AtE2F3 interacted more preferentially with DPa than with DPb, whereas AtE2F2 did better with DPb". ef3-dpb 828344 n/a 828350 unspecified role unspecified role prey prey n/a 828348 unspecified role unspecified role bait bait physical association physical association false false false Figure 2 The authors concluded the yeast assay revealed a differential specificity in the dimerization affinity. AtE2F1 and AtE2F3 interacted more preferentially with DPa than with DPb, whereas AtE2F2 did better with DPb". ef1-dpa 828344 n/a 828345 unspecified role unspecified role prey prey n/a 828346 unspecified role unspecified role bait bait physical association physical association false false false Figure 2 The authors concluded the yeast assay revealed a differential specificity in the dimerization affinity. AtE2F1 and AtE2F3 interacted more preferentially with DPa than with DPb, whereas AtE2F2 did better with DPb". ef2-dpa 828344 n/a 828346 unspecified role unspecified role bait bait n/a 828349 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 The authors concluded the yeast assay revealed a differential specificity in the dimerization affinity. AtE2F1 and AtE2F3 interacted more preferentially with DPa than with DPb, whereas AtE2F2 did better with DPb". ef1-dpb 828344 n/a 828345 unspecified role unspecified role prey prey n/a 828348 unspecified role unspecified role bait bait physical association physical association false false false Figure 2 The authors concluded the yeast assay revealed a differential specificity in the dimerization affinity. AtE2F1 and AtE2F3 interacted more preferentially with DPa than with DPb, whereas AtE2F2 did better with DPb". ef3-dpa 828344 n/a 828346 unspecified role unspecified role bait bait n/a 828350 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 The authors concluded the yeast assay revealed a differential specificity in the dimerization affinity. AtE2F1 and AtE2F3 interacted more preferentially with DPa than with DPb, whereas AtE2F2 did better with DPb".