IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lohrmann-2001-3 The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Lohrmann J., Sweere U., Zabaleta E., Baurle I., Keitel C., Kozma-Bognar L., Brennicke A., Schafer E., Kudla J., Harter K. harterkl@ruf.uni-freiburg.de Mol. Genet. Genomics (1617-4615) 2001 Only protein-protein interactions imex curation lohrmann-2001-4 The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lohrmann J., Sweere U., Zabaleta E., Baurle I., Keitel C., Kozma-Bognar L., Brennicke A., Schafer E., Kudla J., Harter K. harterkl@ruf.uni-freiburg.de Mol. Genet. Genomics (1617-4615) 2001 Only protein-protein interactions imex curation lohrmann-2001-5 The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lohrmann J., Sweere U., Zabaleta E., Baurle I., Keitel C., Kozma-Bognar L., Brennicke A., Schafer E., Kudla J., Harter K. harterkl@ruf.uni-freiburg.de Mol. Genet. Genomics (1617-4615) 2001 Only protein-protein interactions imex curation lohrmann-2001-1 The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 1 hybrid one hybrid yeast one-hybrid yeast one hybrid one-hybrid 1 hybrid yeast one-hybrid one-hybrid yeast one hybrid predetermined predetermined participant predetermined Lohrmann J., Sweere U., Zabaleta E., Baurle I., Keitel C., Kozma-Bognar L., Brennicke A., Schafer E., Kudla J., Harter K. harterkl@ruf.uni-freiburg.de Mol. Genet. Genomics (1617-4615) 2001 Only protein-protein interactions imex curation lohrmann-2001-2 The response regulator ARR2: a pollen-specific transcription factor involved in the expression of nuclear genes for components of mitochondrial complex I in Arabidopsis. in vitro In vitro dnase 1 footprinting DNase I footprinting dnase 1 footprinting predetermined predetermined participant predetermined Lohrmann J., Sweere U., Zabaleta E., Baurle I., Keitel C., Kozma-Bognar L., Brennicke A., Schafer E., Kudla J., Harter K. harterkl@ruf.uni-freiburg.de Mol. Genet. Genomics (1617-4615) 2001 Only protein-protein interactions imex curation psst_arath_gene PSST gene gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress arr2_arath Two-component response regulator ARR2 ARR2 ARP5 At4g16110 dl4095w FCAALL.297 Receiver-like protein 5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MVNPGHGRGPDSGTAAGGSNSDPFPANLRVLVVDDDPTCLMILERMLMTCLYRVTKCNRAESALSLLRKNKNGFDIVISDVHMPDMDGFKLLEHVGLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRIEALKNIWQHVVRKKRNEWNVSEHSGGSIEDTGGDRDRQQQHREDADNNSSSVNEGNGRSSRKRKEEEVDDQGDDKEDSSSLKKPRVVWSVELHQQFVAAVNQLGVDKAVPKKILEMMNVPGLTRENVASHLQKYRIYLRRLGGVSQHQGNMNHSFMTGQDQSFGPLSSLNGFDLQSLAVTGQLPPQSLAQLQAAGLGRPTLAKPGMSVSPLVDQRSIFNFENPKIRFGDGHGQTMNNGNLLHGVPTGSHMRLRPGQNVQSSGMMLPVADQLPRGGPSMLPSLGQQPILSSSVSRRSDLTGALAVRNSIPETNSRVLPTTHSVFNNFPADLPRSSFPLASAPGISVPVSVSYQEEVNSSDAKGGSSAATAGFGNPSYDIFNDFPQHQQHNKNISNKLNDWDLRNMGLVFSSNQDAATATATAAFSTSEAYSSSSTQRKRRETDATVVGEHGQNLQSPSRNLYHLNHVFMDGGSVRVKSERVAETVTCPPANTLFHEQYNQEDLMSAFLKQEGIPSVDNEFEFDGYSIDNIQV tyky_arath_gene NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress nadh_arath_gene NADH dehydrogenase subunit gene gene arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress ahp1_arath Histidine-containing phosphotransfer protein 1 AHP1 ATHP3 At3g21510 MIL23.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVELGF ahp2_arath Histidine-containing phosphotransfer protein 2 AHP2 ATHP1 At3g29350 MUO10.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN arr2-dna-2 809500 n/a 809505 unspecified role unspecified role bait bait n/a 809506 unspecified role unspecified role prey prey region Strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5B The PSST promoter region used was -215 base pairs to -171 base pairs. arr2-dna-3 809500 n/a 809506 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 809505 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 5D The PSST promoter region used was -215 base pairs to -171 base pairs. arr2-dna-4 809500 n/a 809507 unspecified role unspecified role bait bait n/a 809506 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C The TYKY promoter region used was -144 base pairs to -100 base pairs. arr2-dna-5 809500 n/a 809508 unspecified role unspecified role bait bait n/a 809506 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 5C The NADH dehydrogenase promoter region used was -176 base pairs to -132 base pairs. ahp1-arr2 809501 n/a 809506 unspecified role unspecified role prey prey n/a 809509 unspecified role unspecified role bait bait physical association physical association false false false Figure 8A ahp2-arr2-3 809501 n/a 809510 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) n/a 809506 unspecified role unspecified role prey prey n-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 8A, 8D ahp1-arr2-1 809502 n/a 809509 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 809506 unspecified role unspecified role bait bait region Strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 8C ahp2-arr2-1 809502 n/a 809506 unspecified role unspecified role bait bait region Strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 809510 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 8C arr2-dna 809503 n/a 809506 unspecified role unspecified role prey prey n/a 809505 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 3 The PSST promoter construct consisted of a tandem repeat of -235 to -126 base pairs of the promoter region. arr2-psst-1 809504 n/a 809506 unspecified role unspecified role prey prey region Strep tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 809505 unspecified role unspecified role bait bait direct interaction direct interaction false false false Figure 5A The PSST promoter region used was -268 base pairs to -129 base pairs. The authors demonstrated that ARR2 protein interacted with regions -224 to -164 base pairs -259 to -240 base pairs of the PSST promoter region.