IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ park-2001a-3 Interaction of the Arabidopsis receptor protein kinase Wak1 with a glycine-rich protein, AtGRP-3. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Park AR., Cho SK., Yun UJ., Jin MY., Lee SH., Sachetto-Martins G., Park OK. Proteins were identified by accession numbers and references provided in the text. Proteins were identified by accession numbers and references provided in the text. omkim@hotmail.com Arabidopsis seedling cDNA library J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation park-2001a-2 Interaction of the Arabidopsis receptor protein kinase Wak1 with a glycine-rich protein, AtGRP-3. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Park AR., Cho SK., Yun UJ., Jin MY., Lee SH., Sachetto-Martins G., Park OK. Proteins were identified by accession numbers and references provided in the text. Proteins were identified by accession numbers and references provided in the text. omkim@hotmail.com Arabidopsis seedling cDNA library J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation park-2001a-1 Interaction of the Arabidopsis receptor protein kinase Wak1 with a glycine-rich protein, AtGRP-3. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Park AR., Cho SK., Yun UJ., Jin MY., Lee SH., Sachetto-Martins G., Park OK. Proteins were identified by accession numbers and references provided in the text. Proteins were identified by accession numbers and references provided in the text. omkim@hotmail.com Arabidopsis seedling cDNA library J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation park-2001a-4 Interaction of the Arabidopsis receptor protein kinase Wak1 with a glycine-rich protein, AtGRP-3. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Park AR., Cho SK., Yun UJ., Jin MY., Lee SH., Sachetto-Martins G., Park OK. Proteins were identified by accession numbers and references provided in the text. Proteins were identified by accession numbers and references provided in the text. omkim@hotmail.com Arabidopsis seedling cDNA library J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation park-2001a-5 Interaction of the Arabidopsis receptor protein kinase Wak1 with a glycine-rich protein, AtGRP-3. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Park AR., Cho SK., Yun UJ., Jin MY., Lee SH., Sachetto-Martins G., Park OK. Proteins were identified by accession numbers and references provided in the text. Proteins were identified by accession numbers and references provided in the text. omkim@hotmail.com Arabidopsis seedling cDNA library J. Biol. Chem. (0021-9258) 2001 Only protein-protein interactions imex curation wak1_arath Wall-associated receptor kinase 1 WAK1 PRO25 F16F4.6 At1g21250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKVQEGLFLVAIFFSLACTQLVKGQHQPGENCQNKCGNITIEYPFGISSGCYYPGNESFSITCKEDRPHVLSDIEVANFNHSGQLQVLLNRSSTCYDEQGKKTEEDSSFTLENLSLSANNKLTAVGCNALSLLDTFGMQNYSTACLSLCDSPPEADGECNGRGCCRVDVSAPLDSYTFETTSGRIKHMTSFHDFSPCTYAFLVEDDKFNFSSTEDLLNLRNVMRFPVLLDWSVGNQTCEQVGSTSICGGNSTCLDSTPRNGYICRCNEGFDGNPYLSAGCQDVNECTTSSTIHRHNCSDPKTCRNKVGGFYCKCQSGYRLDTTTMSCKRKEFAWTTILLVTTIGFLVILLGVACIQQRMKHLKDTKLREQFFEQNGGGMLTQRLSGAGPSNVDVKIFTEDGMKKATNGYAESRILGQGGQGTVYKGILPDNSIVAIKKARLGDSSQVEQFINEVLVLSQINHRNVVKLLGCCLETEVPLLVYEFITNGTLFDHLHGSMIDSSLTWEHRLKIAIEVAGTLAYLHSSASIPIIHRDIKTANILLDVNLTAKVADFGASRLIPMDKEELETMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGQKALCFKRPQSSKHLVSYFATATKENRLDEIIGGEVMNEDNLKEIQEAARIAAECTRLMGEERPRMKEVAAKLEALRVEKTKHKWSDQYPEENEHLIGGHILSAQGETSSSIGYDSIKNVAILDIETGR grp3_arath Glycine-rich protein 3 At2g05520 GRP3 T20G20.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASKALVLLGLFAVLLVVSEVAAASSATVNSESKETVKPDQRGYGDNGGNYNNGGGYQGGGGNYQGGGGNYQGGGGNYQGGGGRYQGGGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHGCCYRGYNGCSRCCSYAGEAVQTQPGH grp3s_arath Glycine-rich protein 3 short isoform GRP3S F16J10.7 At2g05380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASKTLLLLGLFAFLFIVSEMAAAGTVKSESEETVKPEQHGGGFGDNGGGRYQGGGGHGGHGGGGYQGGGGRYQGGGGRQGGGGSYCRHGCCYKGYHGCSRCCSYAGEAVQTQSGH wak5_arath Wall-associated receptor kinase 5 WAK5 F16F4.9 At1g21230 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKVHSLFLMAIFFYLAYTQLVKAQPRDDCQTRCGDVPIDYPFGISTGCYYPGDDSFNITCEEDKPNVLSNIEVLNFNHSGQLRGLIPRSTVCYDQQTNNDFESLWFRLDNLSFSPNNKFTLVGCNAWALLSTFGIQNYSTGCMSLCDTPPPPNSKCNGVGCCRTEVSIPLDSHRIETQPSRFENMTSVEHFNPCSYAFFVEDGMFNFSSLEDLKDLRNVTRFPVLLDWSIGNQTCEQVVGRNICGGNSTCFDSTRGKGYNCKCLQGFDGNPYLSDGCQDINECTTRIHNCSDTSTCENTLGSFHCQCPSGSDLNTTTMSCIDTPKEEPKYLGWTTVLLGTTIGFLIILLTISYIQQKMRHRKNTELRQQFFEQNGGGMLIQRLSGAGPSNVDVKIFTEEGMKEATDGYNESRILGQGGQGTVYKGILQDNSIVAIKKARLGDRSQVEQFINEVLVLSQINHRNVVKLLGCCLETEVPLLVYEFISSGTLFDHLHGSMFDSSLTWEHRLRIAIEVAGTLAYLHSYASIPIIHRDVKTANILLDENLTAKVADFGASRLIPMDQEQLTTMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVLMELLSGEKALCFERPQSSKHLVSYFVSAMKENRLHEIIDGQVMNEYNQREIQESARIAVECTRIMGEERPSMKEVAAELEALRVKTTKHQWSDQYPKEVEHLLGVQILSTQGDTSSIGYDSIQNVTRLDIETGR wak3_arath Wall-associated receptor kinase 3 WAK3 F16F4.8 At1g21240 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKFQEGVFLVVIFFLAYTQLVKGQHQPREDCKLKCGNVTIEYPFGISTGCYYPGDDNFNLTCVVEEKLLLFGIIQVTNISHSGHVSVLFERFSECYEQKNETNGTALGYQLGSSFSLSSNNKFTLVGCNALSLLSTFGKQNYSTGCLSLCNSQPEANGRCNGVGCCTTEDFSVPFDSDTFQFGSVRLRNQVNNSLDLFNTSVYQFNPCTYAFLVEDGKFNFDSSKDLKNLRNVTRFPVALDWSIGNQTCEQAGSTRICGKNSSCYNSTTRNGYICKCNEGYDGNPYRSEGCKDIDECISDTHNCSDPKTCRNRDGGFDCKCPSGYDLNSSMSCTRPEYKRTRIFLVIIIGVLVLLLAAICIQHATKQRKYTKLRRQFFEQNGGGMLIQRLSGAGLSNIDFKIFTEEGMKEATNGYDESRILGQGGQGTVYKGILPDNTIVAIKKARLADSRQVDQFIHEVLVLSQINHRNVVKILGCCLETEVPLLVYEFITNGTLFDHLHGSIFDSSLTWEHRLRIAIEVAGTLAYLHSSASIPIIHRDIKTANILLDENLTAKVADFGASKLIPMDKEQLTTMVQGTLGYLDPEYYTTGLLNEKSDVYSFGVVLMELLSGQKALCFERPQASKHLVSYFVSATEENRLHEIIDDQVLNEDNLKEIQEAARIAAECTRLMGEERPRMKEVAAKLEALRVEKTKHKWSDQYPEENEHLIGGHILSAQGETSSSIGYDSIKNVAILDIETGR p2c70_arath Protein phosphatase 2C 70 KAPP Kinase-associated protein phosphatase Protein ROOT ATTENUATED GROWTH 1 RAG1 F7K24.30 T24G5.3 At5g19280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMIGMNIIGLFMVLMLLLISLIILFACKPWRYFSRFRSSSRFSSTFKVGDLQRPLISDDGNLIQGQTSEVTREYDLEGACYQNDGLLHSSLTEGRFYKQRLPSSSPHFSQGESFVLEVISEPSDNALVGQTLKLPAEKGSLAEVQTYDWQNNRNENLQYNLEKDRLINLSPRLVEDQRSWLFLEVIAGPAIGLQHAVNSTSSSKLPVKLGRVSPSDLALKDSEVSGKHAQITWNSTKFKWELVDMGSLNGTLVNSHSISHPDLGSRKWGNPVELASDDIITLGTTTKVYVRISSQNEFQIPFKIGVASDPMAMRRGGRKLPMEDVCHYKWPLPGANKFGLFCVCDGHGGSGAAQSAIKIIPEVLANILSDSLRKEKVLSKRDASDVLRDMFAKTEARLEEHQYEGCTATVLLVWKDNEENFFAQCANLGDSACVIHLGGRYIQMTEDHRVVSLSERKRFQEAGLALRDGETRLFGINLARMLGDKFPKQQDSRFSAEPYISEPLRIDQSSKDVFAVLASDGLWDVVSPKKAVQLVLQMRDKERGRESSAEKIANGLLNEARAMRTKDNTSIIYLDFDTSL wak1-grp3-1 809444 n/a 809449 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 809450 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 1C Figure 2B Figure 2D wak1-grp3s-1 809444 n/a 809449 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 809451 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 1C wak5-grp3 809444 n/a 809452 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 809450 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 2B wak3-grp3-1 809444 n/a 809453 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) n/a 809450 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 2B wak1-grp3-2 809445 n/a 809449 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 809450 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1B wak1-grp3s 809445 n/a 809449 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 809451 unspecified role unspecified role prey prey physical association physical association false false false Figure 1B wak1-grp3 809446 n/a 809450 unspecified role unspecified role prey prey n/a 809449 unspecified role unspecified role bait bait extracellular region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false wak1-grp3-kapp 809447 n/a 809449 unspecified role unspecified role bait bait n/a 809454 unspecified role unspecified role prey prey n/a 809450 unspecified role unspecified role prey prey physical association physical association false false false Figure 3 wak1-grp3-kapp-1 809448 n/a 809450 unspecified role unspecified role neutral component neutral component n/a 809454 unspecified role unspecified role neutral component neutral component n/a 809449 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figure 4