mpidb The Microbial Protein Interaction Database elliott-1999-1 Identification of CesT, a chaperone for the type III secretion of Tir in enteropathogenic Escherichia coli. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Elliott SJ., Hutcheson SW., Dubois MS., Mellies JL., Wainwright LA., Batchelor M., Frankel G., Knutton S., Kaper JB. jkaper@umaryland.edu Mol. Microbiol. (0950-382X) 1999 Only protein-protein interactions imex curation elliott-1999-2 Identification of CesT, a chaperone for the type III secretion of Tir in enteropathogenic Escherichia coli. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Elliott SJ., Hutcheson SW., Dubois MS., Mellies JL., Wainwright LA., Batchelor M., Frankel G., Knutton S., Kaper JB. jkaper@umaryland.edu Mol. Microbiol. (0950-382X) 1999 Only protein-protein interactions imex curation elliott-1999-3 Identification of CesT, a chaperone for the type III secretion of Tir in enteropathogenic Escherichia coli. ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Elliott SJ., Hutcheson SW., Dubois MS., Mellies JL., Wainwright LA., Batchelor M., Frankel G., Knutton S., Kaper JB. Mutant strain SE896 was induced to express truncated Tir and His6CesT, treated with DSP (Dithiobis[succinimidyl propionate]) and the His-tagged proteins in cell lysates collected on a Ni2+-NTA column. jkaper@umaryland.edu Mol. Microbiol. (0950-382X) 1999 Only protein-protein interactions imex curation elliott-1999-4 Identification of CesT, a chaperone for the type III secretion of Tir in enteropathogenic Escherichia coli. ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Elliott SJ., Hutcheson SW., Dubois MS., Mellies JL., Wainwright LA., Batchelor M., Frankel G., Knutton S., Kaper JB. E2348/69 was grown in MEM and treated with the thiol cleavable cross-linker DSP (Dithiobis[succinimidyl propionate]). Antibodies raised against Tir were bound to Protein A-Sepharose beads and mixed with a cytoplasmic preparation obtained from the treated E2348/69 jkaper@umaryland.edu Mol. Microbiol. (0950-382X) 1999 Only protein-protein interactions imex curation tir_eco27 Translocated intimin receptor Tir tir Secreted effector protein Tir espE E2348C_3941 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MPIGNLGNNVNGNHLIPPAPPLPSQTDGAARGGTGHLISSTGALGSRSLFSPLRNSMADSVDSRDIPGLPTNPSRLAAATSETCLLGGFEVLHDKGPLDILNTQIGPSAFRVEVQADGTHAAIGEKNGLEVSVTLSPQEWSSLQSIDTEGKNRFVFTGGRGGSGHPMVTVASDIAEARTKILAKLDPDNHGGRQPKDVDTRSVGVGSASGIDDGVVSETHTSTTNSSVRSDPKFWVSVGAIAAGLAGLAATGIAQALALTPEPDDPTTTDPDQAANAAESATKDQLTQEAFKNPENQKVNIDANGNAIPSGELKDDIVEQIAQQAKEAGEVARQQAVESNAQAQQRYEDQHARRQEELQLSSGIGYGLSSALIVAGGIGAGVTTALHRRNQPAEQTTTTTTHTVVQQQTGGNTPAQGGTDATRAEDASLNRRDSQGSVASTHWSDSSSEVVNPYAEVGGARNSLSAHQPEEHIYDEVAADPGYSVIQNFSGSGPVTGRLIGTPGQGIQSTYALLANSGGLRLGMGGLTSGGESAVSSVNAAPTPGPVRFV cest_eco27 Tir chaperone cesT E2348C_3940 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MSSRSELLLDRFAEKIGVGSISFNENRLCSFAIDEIYYISLSDANDEYMMIYGVCGKFPTDNPNFALEILNANLWFAENGGPYLCYESGAQSLLLALRFPLDDATPEKLENEIEVVVKSMENLYLVLHNQGITLENEHMKIEEISSSDNKHYYAGR cest_tir 865743 n/a 865747 unspecified role unspecified role bait bait n/a 865748 unspecified role unspecified role prey prey physical association physical association false false false Table 1 cest_tir-2 865744 n/a 865748 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 865747 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 9 cest_tir-3 865745 n/a 865748 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 865747 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 11 cest_tir-4 865746 n/a 865747 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) n/a 865748 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 10