MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint makino-1999-1 The GTPase activating factor for transducin in rod photoreceptors is the complex between RGS9 and type 5 G protein beta subunit. bovine-rod outer seg Bos taurus retina-rod_outer_segment rod outer segment coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Makino ER., Handy JW., Li T., Arshavsky VY. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 makino-1999-2 The GTPase activating factor for transducin in rod photoreceptors is the complex between RGS9 and type 5 G protein beta subunit. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. coip coimmunoprecipitation co-immunoprecipitation CoIp immunoprecipitation Co-IP co-immunoprecipitation CoIp immunoprecipitation Co-IP coip predetermined predetermined participant predetermined Makino ER., Handy JW., Li T., Arshavsky VY. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 makino-1999-3 The GTPase activating factor for transducin in rod photoreceptors is the complex between RGS9 and type 5 G protein beta subunit. bovine-rod outer seg Bos taurus retina-rod_outer_segment rod outer segment ion exchange chrom ion exchange chromatography IEC IEC ion exchange chrom predetermined predetermined participant predetermined Makino ER., Handy JW., Li T., Arshavsky VY. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 makino-1999-4 The GTPase activating factor for transducin in rod photoreceptors is the complex between RGS9 and type 5 G protein beta subunit. bovine-rod outer seg Bos taurus retina-rod_outer_segment rod outer segment molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Makino ER., Handy JW., Li T., Arshavsky VY. Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 1999 rgs9_bovin Regulator of G-protein signaling 9 RGS9 protein protein bovin Bos taurus (Bovine) Bovine MTIRHQGQQYRPRMAFLRKIEALVKDMQDPDTGVRVQNQKVKVVSIPHAMTGSDVLQWISQRLWISGLEAQNLGNFIVKYGYIYPLQDPRNLTLKPDSSLYRFQTPYFWPTQQWPAEDVDYAIYLAKRNIKKKGILEEYEKENYNFLNKKINYKWDFVIMQAREQYRAGKERNKVDRCALDCQEKAYWLVHRCPPGANNVLDYGLDRVTNPNEDQKQTVVSVRKEIMYYRQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVDIPTKMRVERWAFNFSELIRDPKGRQSFQHFLRKEFSGENLGFWEACEDLKYGDQSKVKEKAEEIYKLFLAPGARRWINIDGKTMDITVKGLKHPHRYVLDAAQTHIYMLMKKDSYARYLKSPIYKEMLAKAIEPQGTTRKSSSLPFMRRHLRSSPSPVILRQLEEEAKAREAATTVDITQVMSKLDRRSQLRKEPPPK Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(t)-alpha. Involved in phototransduction; key element in the recovery phase of visual transduction mint a5pjs1_bovin GNB5 protein protein bovin Bos taurus (Bovine) Bovine MAADGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRLVSSSQDGKVIVWDSFTTNKEHAVTMPCTWVMACAYAPSGCAIACGGLDNKCSVYPLTFDKNENMAAKKKSVAMHTNYLSACSFTNSDMQILTASGDGTCALWDVESGQLLQSFHGHGADVLCLDLAPSETGNTFVSGGCDKKAMVWDMRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVAIYSKESIIFGASSVDFSLSGRLLFAGYNDYTINVWDVLKGSRVSILFGHENRVSTLRVSPDGTAFCSGSWDHTLRVWA mint rgs9-gnb5 793420 rgs9_bovin RGS9 793424 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level a5pjs1_bovin GB5L 793425 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3A mint gnb5-rgs9 793420 a5pjs1_bovin GB5L 793425 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level rgs9_bovin RGS9 793424 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F3B mint rgs9-gnb5-1 793421 rgs9_bovin RGS9 793424 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell a5pjs1_bovin GB5L 793425 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell physical association physical association false false false F4 mint gnb5-rgs9-1 793422 a5pjs1_bovin GB5L 793425 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level rgs9_bovin RGS9 793424 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false F2 mint gnb5-rgs9-2 793423 a5pjs1_bovin GB5L 793425 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level rgs9_bovin RGS9 793424 western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization false false false F1E mint