MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schrem-1999-1 Identification of a domain in guanylyl cyclase-activating protein 1 that interacts with a complex of guanylyl cyclase and tubulin in photoreceptors. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Schrem A., Lange C., Beyermann M., Koch KW. J. Biol. Chem. (0021-9258) 1999 schrem-1999-2 Identification of a domain in guanylyl cyclase-activating protein 1 that interacts with a complex of guanylyl cyclase and tubulin in photoreceptors. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Schrem A., Lange C., Beyermann M., Koch KW. J. Biol. Chem. (0021-9258) 1999 guc1a_bovin Guanylyl cyclase-activating protein 1 GUCA1A GCAP1 GUCA1 Guanylate cyclase activator 1A protein protein bovin Bos taurus (Bovine) Bovine MGNIMDGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPWASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRAINPCSDSTMTAEEFTDTVFSKIDVNGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGASGRETEAAEADG mint Stimulates guanylyl cyclase 1 (GC1) when free calcium ions concentration is low and inhibits GC1 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure guc2d_bovin Retinal guanylyl cyclase 1 GUCY2D GUC2D Guanylate cyclase 2D, retinal Rod outer segment membrane guanylate cyclase Guanylate cyclase E protein protein bovin Bos taurus (Bovine) Bovine MTACTFLAGGLRDPGLCGPTRWAPSPPGLPPIPPRPRLRLRPPLLLLLLLPRSVLSAVFTVGVLGPWACDPIFARARPDLAARLAASRLNHAAALEGGPRFEVALLPEPCRTPGSLGAVSSALTRVSGLVGPVNPAACRPAELLAQEAGVALVPWGCPGTRAAGTTAPVVTPAADALYALLRAFRWAHVALVTAPQDLWVEAGHALSTALRARGLPVALVTSMEPSDLSGAREALRRVQDGPRVRAVIMVMHSVLLGGEEQRCLLEAAEELGLADGSLVFLPFDTLHYALSPGPDALAVLANSSQLRKAHDAVLTLTRHCPLGGSVRDSLRRAQEHRELPLDLNLQQVSPLFGTIYDSVFLLAGGVARARVAAGGGWVSGAAVARHIRDARVPGFCGALGGAEEPSFVLLDTDATGDQLFATYVLDPTQGFFHSAGTPVHFPKGGRGPGPDPSCWFDPDTICNGGVEPSVVFIGFLLVVGMGLAGAFLAHYCRHRLLHIQMVSGPNKIILTLDDITFLHPHGGNSRKVAQGSRTSLAARSISDVRSIHSQLPDYTNIGLYEGDWVWLKKFPGDRHIAIRPATKMAFSKIRELRHENVALYLGLFLAGGAGGPAAPGEGVLAVVSEHCARGSLQDLLAQRDIKLDWMFKSSLLLDLIKGIRYLHHRGVAHGRLKSRNCVVDGRFVLKVTDHGHGRLLEAQRVLPEPPSAEDQLWTAPELLRDPVLERRGTLAGDVFSLGIIMQEVVCRSAPYAMLELTPEEVVKRVQSPPPLCRPSVSIDQAPMECIQLMKQCWAEQPELRPSMDRTFELFKSINKGRKMNIIDSMLRMLEQYSSNLEDLIRERTEELELEKQKTDRLLTQMLPPSVAEALKMGTPVEPEYFEEVTLYFSDIVGFTTISAMSEPIEVVDLLNDLYTLFDAIIGSHDVYKVETIGDAYMVASGLPQRNGHRHAAEIANMALDILSAVGTFRMRHMPEVPVRIRIGLHSGPCVAGVVGLTMPRYCLFGDTVNTASAMESTGLPYRIHVNRSTVQILSALNEGFLTEVRGRTELKGKGAEETYWLVGRRGFNKPIPKPPDLQPGASNHGISLHEIPPDRRQKLEKARPGQFSGK Probably plays a specific functional role in the rods and/or cones of photoreceptors. It may be the enzyme involved in the resynthesis of cGMP required for recovery of the dark state after phototransduction mint tba4a_bovin Tubulin alpha-4A chain TUBA1 TUBA4A Tubulin alpha-1 chain Alpha-tubulin 1 protein protein bovin Bos taurus (Bovine) Bovine MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE mint Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain guca1a-gucy2d 793401 guc1a_bovin GCAP-1 793403 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level guc2d_bovin ROS-GC 793404 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F7A mint guca1a-tuba4a 793401 tba4a_bovin tubulin 793405 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level guc1a_bovin GCAP-1 793403 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F7B homomint mint guca1a-gucy2d-1 793402 guc1a_bovin GCAP-1 793403 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false guc2d_bovin ROS-GC 793404 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F6B mint guca1a-tuba4a-1 793402 tba4a_bovin tubulin 793405 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level guc1a_bovin GCAP-1 793403 peptide synthesis peptide synthesis unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F6D homomint mint