UniProt UniProt http://www.uniprot.org zanchin-1999-1 Nip7p interacts with Nop8p, an essential nucleolar protein required for 60S ribosome biogenesis, and the exosome subunit Rrp43p. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast pull down pull down western blot western blot Immuno blot Immuno blot Zanchin NI., Goldfarb DS. dasg@uhura.cc.rochester.edu Yeast cDNA library. Mol. Cell. Biol. (1518-1525) 1999 Only protein-protein interactions imex curation zanchin-1999-2 Nip7p interacts with Nop8p, an essential nucleolar protein required for 60S ribosome biogenesis, and the exosome subunit Rrp43p. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Zanchin NI., Goldfarb DS. dasg@uhura.cc.rochester.edu Yeast cDNA library. Mol. Cell. Biol. (1518-1525) 1999 Only protein-protein interactions imex curation zanchin-1999-3 Nip7p interacts with Nop8p, an essential nucleolar protein required for 60S ribosome biogenesis, and the exosome subunit Rrp43p. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zanchin NI., Goldfarb DS. dasg@uhura.cc.rochester.edu Yeast cDNA library. Mol. Cell. Biol. (1518-1525) 1999 Only protein-protein interactions imex curation nip7_yeast 60S ribosome subunit biogenesis protein NIP7 YPL211W NIP7 Nuclear import protein 7 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRQLTEEETKVVFEKLAGYIGRNISFLVDNKELPHVFRLQKDRVYYVPDHVAKLATSVARPNLMSLGICLGKFTKTGKFRLHITSLTVLAKHAKYKIWIKPNGEMPFLYGNHVLKAHVGKMSDDIPEHAGVIVFAMNDVPLGFGVSAKSTSESRNMQPTGIVAFRQADIGEYLRDEDTLFT 82EAE8E4B2FCC31A rrp43_yeast Exosome complex component RRP43 RRP43 YCR035C YCR35C YCR522 Ribosomal RNA-processing protein 43 protein protein yeast Saccharomyces cerevisiae Baker's yeast MAESTTLETIEIHPITFPPEVLARISPELSLQRHLSLGIRPCLRKYEEFRDVAIENNTLSRYADAGNIDTKNNILGSNVLKSGKTIVITSITGGIIEETSAAIKDLDDFGEEELFEVTKEEDIIANYASVYPVVEVERGRVGACTDEEMTISQKLHDSILHSRILPKKALKVKAGVRSANEDGTFSVLYPDELEDDTLNETNLKMKRKWSYVLYAKIVVLSRTGPVFDLCWNSLMYALQSVKLPRAFIDERASDLRMTIRTRGRSATIRETYEIICDQTKSVPLMINAKNIAFASNYGIVELDPECQLQNSDNSEEEEVDIDMDKLNTVLIADLDTEAEETSIHSTISILAAPSGNYKQLTLVGGGAKITPEMIKRSLLLSRVRADDLSTRFNI 8801837B8184134D nop8_yeast 60S ribosome subunit biogenesis protein NOP8 YOL144W Nucleolar protein 8 NOP8 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDSVIQKRIFVGNIFHNADDCYSELLDRFGKFGDCQDFQFEKHNHFAFIDIRFNDEADFNKLRKSFNNVKFKGNILKVDEAKPNWESTWAVQHAKDLKEDIILNAKMKKKNWQHYKKMENVAKSWKDHKEVIAGRMREAPRKRSQLRNITFRINVNGSLKVYKCYKTKLWGYERNKELNDLVYKFTNNFWKNGYNHIVDRLDYSRAVKTVRFKNGLKQLTVSKDENVCSGEMDSDENMSEEEKEKNNVILNDLLKDFDFDKPMTLNDSDEELLTEQRKGEEEEEEEEEKEVNAPEYENVNKTKDQSTLPQEKPEERKEQDEGDGQEDNEFIPTFTKEIGQGTISNTETLRNLFNPNEAEPVSQFKLIEDSDNDIDHAKDVDVNQLEEEVSKSSDTLGLTSAPVPHVSRDKDNKNFLFFPHLQSPFLVGQTQLSKVRAPGRETMLSNWDEEFWANRGNWTRDMRRKMKDALKHRKRKQSKSGLLL rrp43-nip7 779944 n/a 779947 unspecified role unspecified role prey prey n/a 779948 unspecified role unspecified role bait bait n-terminal protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2B nop8-nip7 779944 n/a 779947 unspecified role unspecified role prey prey n/a 779949 unspecified role unspecified role bait bait n-terminal protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig. 2C nip7-rrp43 779945 n/a 779947 unspecified role unspecified role bait bait n/a 779948 unspecified role unspecified role prey prey physical association physical association false false false No figure. nip7-nop8 779945 n/a 779947 unspecified role unspecified role bait bait n/a 779949 unspecified role unspecified role prey prey physical association physical association false false false No figure. nip7-rrp43-1 779946 n/a 779947 unspecified role unspecified role bait bait n/a 779948 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A nip7-nop8-1 779946 n/a 779947 unspecified role unspecified role bait bait n/a 779949 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A