IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ propper-1999-1 Analysis of the MRP8-MRP14 protein-protein interaction by the two-hybrid system suggests a prominent role of the C-terminal domain of S100 proteins in dimer formation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Propper C., Huang X., Roth J., Sorg C., Nacken W. The beta galactosidase activity was used to determine the strength of interaction. nacken@uni-muenster.de,nacken@uni-muenster.de J. Biol. Chem. (0021-9258) 1999 Only protein-protein interactions imex curation s10a9_mouse Protein S100-A9 S100a9 Cagb Mrp14 S100 calcium-binding protein A9 Calgranulin-B Migration inhibitory factor-related protein 14 Leukocyte L1 complex heavy chain protein protein mouse Mus musculus Mouse MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK s10a8_mouse Protein S100-A8 S100a8 Caga Mrp8 S100 calcium-binding protein A8 Calgranulin-A Migration inhibitory factor-related protein 8 Leukocyte L1 complex light chain Chemotactic cytokine CP-10 Pro-inflammatory S100 cytokine protein protein mouse Mus musculus Mouse MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE s10a9_human Protein S100-A9 S100 calcium-binding protein A9 Calgranulin-B Migration inhibitory factor-related protein 14 Leukocyte L1 complex heavy chain Calprotectin L1H subunit S100A9 CAGB CFAG MRP14 protein protein human Homo sapiens Human MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP s10a8_human Protein S100-A8 S100A8 CAGA MRP8 CFAG S100 calcium-binding protein A8 Calgranulin-A Migration inhibitory factor-related protein 8 Cystic fibrosis antigen Leukocyte L1 complex light chain Calprotectin L1L subunit Urinary stone protein band A protein protein human Homo sapiens Human MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE mrp14-hummus N-terminal Human and C-terminal Mouse protein protein human Homo sapiens Human MTCKMSQLERNIETIINTFHQYSVKLGHPDTLRQMVEAQLATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHGHSHGKGCGK An amino acid sequence which is not represented in UniProt mrp14-mushum N terminal Mrp14 Mouse and C-terminal MRP14 Human protein protein mouse Mus musculus Mouse MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP An amino acid sequence which is not represented in UniProt mrp8-mrp14 774615 n/a 774616 unspecified role unspecified role prey prey n/a 774617 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 109 units 3 109 units mrp8-mrp14-1 774615 n/a 774617 unspecified role unspecified role prey prey n/a 774616 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 92 units 3 92 units mrp8-mrp8-1 774615 n/a 774617 unspecified role unspecified role bait bait n/a 774617 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 32 units 3 32 units mrp14-mrp14 774615 n/a 774616 unspecified role unspecified role prey prey n/a 774616 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P31725:p.Phe20Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P31725:p.Phe89Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false P31725:p.Leu95Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 28 units 3, 4 Table1 28 units mrp8-mrp14-2 774615 n/a 774618 unspecified role unspecified role prey prey n/a 774619 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 89 units 3 89 units mrp8-mrp14-3 774615 n/a 774619 unspecified role unspecified role prey prey n/a 774618 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P06702:p.Cys3Ser mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 84 units 3, table 1 84 units hmmrp14-mrp8 774615 n/a 774620 unspecified role unspecified role bait bait n/a 774617 unspecified role unspecified role prey prey physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 64 units Table1 64 units mhmrp14-mrp8-1 774615 n/a 774619 unspecified role unspecified role prey prey n/a 774621 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. 52 units Table1 52 units