IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bogdanova-1997-1 Cysteine synthesis in plants: protein-protein interactions of serine acetyltransferase from Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bogdanova N., Hell R. The protein sequence for 0-acetylserine (thiol) lyase was obtained from Hell et al 1994 (PMID 8082776) , the protein sequence could not be mapped to a UniProtKB identifier and was entered into the protein editor. Other proteins were identified from references provided in the text. hell@rz.rurh-uni-bochum.de Plant J. (0960-7412) 1997 q39218-2 Serine acetyltransferase 3, mitochondrial protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAACIDTCRTGKPQISPRDSSKHHDDESGFRYMNYFRYPDRSSFNGTQTKTLHTRPLLEDLDRDAEVDDVWAKIREEAKSDIAKEPIVSAYYHASIVSQRSLEAALANTLSVKLSNLNLPSNTLFDLFSGVLQGNPDIVESVKLDLLAVKERDPACISYVHCFLHFKGFLACQAHRIAHELWTQDRKILALLIQNRVSEAFAVDFHPGAKIGTGILLDHATAIVIGETAVVGNNVSILHNVTLGGTGKQCGDRHPKIGDGVLIGAGTCILGNITIGEGAKIGAGSVVLKDVPPRTTAVGNPARLLGGKDNPKTHDKIPGLTMDQTSHISEWSDYVI cysk1_arath Cysteine synthase 1 OASA1 OAS1 OASS At.OAS.5-8 CSase A Cys-3A O-acetylserine sulfhydrylase Beta-substituted Ala synthase 1;1 O-acetylserine (thiol)-lyase 1 OLD3 Protein ONSET OF LEAF DEATH 3 dl3480c At4g14880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASRIAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHKIQGIGAGFIPSVLNVDLIDEVVQVSSDESIDMARQLALKEGLLVGISSGAAAAAAIKLAQRPENAGKLFVAIFPSFGERYLSTVLFDATRKEAEAMTFEA sat1_arath Serine acetyltransferase 1, chloroplastic SAT1 SAT5 F14J16.18 At1g55920 SAT-p AtSERAT2;1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATCIDTCRTGNTQDDDSRFCCIKNFFRPGFSVNRKIHHTQIEDDDDVWIKMLEEAKSDVKQEPILSNYYYASITSHRSLESALAHILSVKLSNLNLPSNTLFELFISVLEESPEIIESTKQDLIAVKERDPACISYVHCFLGFKGFLACQAHRIAHTLWKQNRKIVALLIQNRVSESFAVDIHPGAKIGKGILLDHATGVVIGETAVVGDNVSILHGVTLGGTGKQSGDRHPKIGDGVLIGAGSCILGNITIGEGAKIGSGSVVVKDVPARTTAVGNPARLIGGKENPRKHDKIPCLTMDQTSYLTEWSDYVI oas-sat3 0-acetylserine (thiol) lyase interacts with SAT3 723024 N/A 723025 unspecified role unspecified role prey prey c-terminal required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 723026 unspecified role unspecified role bait bait physical association physical association false false false Table 2, Figure 2 sat3-oas SAT3 interacts with 0-acetylserine (thiol) lyase 723024 N/A 723025 unspecified role unspecified role bait bait N/A 723026 unspecified role unspecified role prey prey physical association physical association false false false Table 2 oas-oas 0-acetylserine (thiol) lyase homodimer 723024 N/A 723026 unspecified role unspecified role prey prey N/A 723026 unspecified role unspecified role bait bait physical association physical association false false false Table 2 The authors note "self association of 0-acetylserine (thiol) lyase could only be demonstrated after prolonged growth of transformed cells". sat1-oas SAT1 interacts with 0-acetylserine (thiol) lyase 723024 N/A 723027 unspecified role unspecified role bait bait N/A 723026 unspecified role unspecified role prey prey physical association physical association false false false Table 2 oas-1-sat1 0-acetylserine (thiol) lyase interacts with SAT1 723024 N/A 723027 unspecified role unspecified role prey prey N/A 723026 unspecified role unspecified role bait bait physical association physical association false false false Table 2 sat1 SAT1 homodimer 723024 N/A 723027 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 723027 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3 , Figure 4, Figure 5 The region required for protein interaction is taken from Figure 5. sat3 SAT3 homodimer 723024 N/A 723025 unspecified role unspecified role prey prey N/A 723025 unspecified role unspecified role bait bait physical association physical association false false false Figure 4 sat1-sat3 Interaction between SAT1 and SAT3 723024 N/A 723027 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A 723025 unspecified role unspecified role prey prey physical association physical association false false false Figure 3B, Figure 5 The region of SAT1 required for protein interaction is taken from Figure 5.