MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint malojci_-2008-1 Preparation and structure of the charge-transfer intermediate of the transmembrane redox catalyst DsbB. in vitro In vitro biochemical biochemical predetermined predetermined participant predetermined Malojcić G., Owen RL., Grimshaw JP., Glockshuber R. mgoran@ethz.ch FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation malojcic-2008-1 Preparation and structure of the charge-transfer intermediate of the transmembrane redox catalyst DsbB. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Malojcić G., Owen RL., Grimshaw JP., Glockshuber R. mgoran@ethz.ch FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation malojcic-2008-2 Preparation and structure of the charge-transfer intermediate of the transmembrane redox catalyst DsbB. in vitro In vitro ms of complexes mass spectrometry studies of complexes ms of complexes predetermined predetermined participant predetermined Malojcić G., Owen RL., Grimshaw JP., Glockshuber R. mgoran@ethz.ch FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation malojcic-2008-3 Preparation and structure of the charge-transfer intermediate of the transmembrane redox catalyst DsbB. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Malojcić G., Owen RL., Grimshaw JP., Glockshuber R. mgoran@ethz.ch FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation dsbb_ecoli Disulfide bond formation protein B dsbB roxB b1185 JW5182 ycgA Disulfide oxidoreductase protein protein ecoli Escherichia coli (strain K12) MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALIGAIAPKTPLRYVAMVIWLYSAFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLVVISQPFKAKKRDLFGR dsba_ecoli Thiol:disulfide interchange protein DsbA dsbA dsf ppfA b3860 JW3832 protein protein ecoli Escherichia coli (strain K12) MKKIWLALAGLVLAFSASAAQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK dsba-dsbb 762081 dsbb_ecoli 762085 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dsba_ecoli 762086 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F2 A mutated DsbA (Cys33Ala) form was used in the experiment. mint dsba-dsbb-1 762082 dsbb_ecoli 762085 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dsba_ecoli 762086 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified colocalization colocalization false false false F2 A mutated DsbA (Cys33Ala) form was used in the experiment. mint dsba-dsbb-2 762083 dsba_ecoli 762086 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dsbb_ecoli 762085 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F2 A mutated DsbA (Cys33Ala) form was used in the experiment. mint dsba-dsbb-3 762084 dsba_ecoli 762086 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified dsbb_ecoli 762085 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3 A mutated DsbA (Cys33Ala) form was used in the experiment. mint