IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wang-2008c-1 Novel nuclear protein ALC-INTERACTING PROTEIN1 is expressed in vascular and mesocarp cells in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wang F., Shi DQ., Liu J., Yang WC. wcyang@genetics.ac.cn Arabidopsis whole plant cDNA library. J. Integr. Plant Biol. (1672-9072) 2008 Only protein-protein interactions imex curation wang-2008c-2 Novel nuclear protein ALC-INTERACTING PROTEIN1 is expressed in vascular and mesocarp cells in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wang F., Shi DQ., Liu J., Yang WC. wcyang@genetics.ac.cn Arabidopsis whole plant cDNA library. J. Integr. Plant Biol. (1672-9072) 2008 Only protein-protein interactions imex curation wang-2008c-3 Novel nuclear protein ALC-INTERACTING PROTEIN1 is expressed in vascular and mesocarp cells in Arabidopsis. allce Allium cepa (Onion) Onion bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Wang F., Shi DQ., Liu J., Yang WC. Partical bombardment was used to transform onion (Allium cepa) tissue with fluorescent tagged protein expression constructs. wcyang@genetics.ac.cn Arabidopsis whole plant cDNA library. J. Integr. Plant Biol. (1672-9072) 2008 Only protein-protein interactions imex curation q9m035_arath ACI1 ALC-interacting protein 1 TON1 Recruiting Motif 29 TRM29 T10O8.80 T10O8_80 At5g01370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTQRANPKTGCLTAVVRRLLCSGSQQTHPSDNILDSDETLQLLISYEENEEPKKEIKTETETQNDDVSLHPPPPPPPPNVVAKLMGLDHPAPGSKRFRYFDDSGSAVTRSKSVNFMDYILKGHEEEEENEDEKDGQRQCRRVKASVSFREIVPTSARWSSNNQQKKHDFLLLYLDKLDEKRELVGSSSFSRSKRFEKVVEDSKKPPLPPSAPKKKENEKVAKKFKDEPRKVAKKKKSENRNDVNGAKKVRWFLSPSKSKSSSEKTALLGESKNIRADEFIGKESESPENKSNASPVSVLDRDLYDYLILDDDYYFSGGDSESASELSTKQVETATKSSCSSSPAKTKTSTKKENNNSTNNDSEETEFITKLMNMLSDLSEEDMKSSTWVSTSSTKPVDFTQVEDFCVEFGQEILDLVMDQLVDELCI q8gwq7_arath At5g58630/mzn1_80 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKMKSSPSPASSLSLGSKTRSFGCISIILQRFLCSGTSSTYPSDLITEPSFKSRDFIPEPLRGRGDGPGAVARLMGLDSIPVIDKTRFLSRSHSVNHLKRDDDEIQGKHRRVKSTLEYVELEDDDFFILSFEKDKNDKELGTRNCKKRRDTRGNQSKTEDQTHLEGKENNINAMNVSPGRERLEIGELMQRRKEKRKSRRKRKETKLRQNIEKENWVQSNGCWSKEEDLVNCEVRSTKEEEECGSCDDSSPVSVLDYDRYAGVRVTPSPGNISRRRLSSELESSKLNETIEQDHITLTSRSKDQEIRLHGYQEMWLMICKLTVSDLEGSDWFNGKALKLEDIEGIISEDIVSNILDQLLEETITTLSLTSQV at5g58630-at5g01370 At5g58630 (ALC) interacts with At5g01370 (ACI1) 762933 N/A 762936 unspecified role unspecified role prey prey N/A 762937 unspecified role unspecified role bait bait physical association physical association false false false at5g58630-at5g01370- At5g58630 (ALC) interacts with At5g01370 (ACI1) 762934 N/A-x 762936 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false N/A-x 762937 unspecified role unspecified role bait bait n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1C alc-aci1 At5g58630 (ALC) interacts with At5g01370 (ACI1) 762935 N/A 762937 unspecified role unspecified role neutral component neutral component region N-terminal region of Yellow Fluorescent Protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 762936 unspecified role unspecified role neutral component neutral component region C-terminal region of Yellow Fluorescent Protein yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 1D