IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ andeme_ondz-2008-1 Arabidopsis Protein Disulfide Isomerase-5 Inhibits Cysteine Proteases during Trafficking to Vacuoles before Programmed Cell Death of the Endothelium in Developing Seeds. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Andeme Ondzighi C., Christopher DA., Cho EJ., Chang SC., Staehelin LA. ondzighi@colorado.edu Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation andeme_ondz-2008-2 Arabidopsis Protein Disulfide Isomerase-5 Inhibits Cysteine Proteases during Trafficking to Vacuoles before Programmed Cell Death of the Endothelium in Developing Seeds. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Andeme Ondzighi C., Christopher DA., Cho EJ., Chang SC., Staehelin LA. ondzighi@colorado.edu Arabidopsis 3 day old etiolated seedling cDNA library and Arabidopsis 3 day old seedling treated with osmotic and hormone treatments. Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation andeme_ondz-2008-3 Arabidopsis Protein Disulfide Isomerase-5 Inhibits Cysteine Proteases during Trafficking to Vacuoles before Programmed Cell Death of the Endothelium in Developing Seeds. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Andeme Ondzighi C., Christopher DA., Cho EJ., Chang SC., Staehelin LA. ondzighi@colorado.edu Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation andeme_ondz-2008-4 Arabidopsis Protein Disulfide Isomerase-5 Inhibits Cysteine Proteases during Trafficking to Vacuoles before Programmed Cell Death of the Endothelium in Developing Seeds. arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy immunostaining immunostaining Andeme Ondzighi C., Christopher DA., Cho EJ., Chang SC., Staehelin LA. ondzighi@colorado.edu Plant Cell (1040-4651) 2008 Only protein-protein interactions imex curation pdi11_arath Protein disulfide isomerase-like 1-1 At1g21750 F8K7.19 PDIL1-1 PDI5 Protein disulfide-isomerase 1 Protein disulfide-isomerase 5 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMRGFTLFSILVLSLCASSIRSEETETKEFVLTLDHTNFTDTINKHDFIVVEFYAPWCGHCKQLAPEYEKAASALSSNVPPVVLAKIDASEETNREFATQYEVQGFPTIKIFRNGGKAVQEYNGPREAEGIVTYLKKQSGPASAEIKSADDASEVVSDKKVVVVGIFPKLSGSEFDSFMAIAEKLRSELDFAHTSDAKLLPRGESSVTGPVVRLFKPFDEQFVDSKDFDGEALEKFVKESSIPLITVFDKDPNNHPYVIKFFESTNTKAMLFINFTGEGAESLKSKYREVATSNKGQGLSFLLGDAENSQGAFQYFGLEESQVPLIIIQTADDKKYLKTNVEVDQIESWVKDFKDGKIAPHKKSQPIPAENNEPVKVVVSDSLDDIVLNSGKNVLLEFYAPWCGHCQKLAPILDEVAVSYQSDSSVVIAKLDATANDFPKDTFDVKGFPTIYFKSASGNVVVYEGDRTKEDFISFVDKNKDTVGEPKKEEETTEEVKDEL rd21c_arath Probable cysteine protease RD21C RD21C MLD14.12 At3g19390 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATSIKSITLALLIFSVLLISLSLGSVTATETTRNEAEARRMYERWLVENRKNYNGLGEKERRFEIFKDNLKFVEEHSSIPNRTYEVGLTRFADLTNDEFRAIYLRSKMERTRVPVKGEKYLYKVGDSLPDAIDWRAKGAVNPVKDQGSCGSCWAFSAIGAVEGINQIKTGELISLSEQELVDCDTSYNDGCGGGLMDYAFKFIIENGGIDTEEDYPYIATDVNVCNSDKKNTRVVTIDGYEDVPQNDEKSLKKALANQPISVAIEAGGRAFQLYTSGVFTGTCGTSLDHGVVAVGYGSEGGQDYWIVRNSWGSNWGESGYFKLERNIKESSGKCGVAMMASYPTKSSGSNPPKPPAPSPVVCDKSNTCPAKSTCCCLYEYNGKCYSWGCCPYESATCCDDGSSCCPQSYPVCDLKANTCRMKGNSPLSIKALTRGPAIATTKSTNMLVGSA rd21b_arath Probable cysteine protease RD21B RD21B MMG4.7 At5g43060 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGFLKLSPMILLLAMIGVSYAMDMSIISYDENHHITTETSRSDSEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNLRFIDEHNTKNLSYKLGLTRFADLTNEEYRSMYLGAKPTKRVLKTSDRYQARVGDALPDSVDWRKEGAVADVKDQGSCGSCWAFSTIGAVEGINKIVTGDLISLSEQELVDCDTSYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAADGRCDQNRKNAKVVTIDSYEDVPENSEASLKKALAHQPISVAIEAGGRAFQLYSSGVFDGLCGTELDHGVVAVGYGTENGKDYWIVRNSWGNRWGESGYIKMARNIEAPTGKCGIAMEASYPIKKGQNPPNPGPSPPSPIKPPTTCDKYFSCPESNTCCCLYKYGKYCFGWGCCPLEAATCCDDNSSCCPHEYPVCDVNRGTCLMSKNSPFSVKALKRTPAIPFWAKSRKHIA rd21a_arath Cysteine proteinase RD21A RD21A Protein RESPONSIVE TO DEHYDRATION 21 F2G19.31 At1g47128 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGFLKPTMAILFLAMVAVSSAVDMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLVEKDRRFEIFKDNLRFVDEHNEKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKKGERRTSLRYEARVGDELPESIDWRKKGAVAEVKDQGGCGSCWAFSTIGAVEGINQIVTGDLITLSEQELVDCDTSYNEGCNGGLMDYAFEFIIKNGGIDTDKDYPYKGVDGTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAHQPISIAIEAGGRAFQLYDSGIFDGSCGTQLDHGVVAVGYGTENGKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGIAIEPSYPIKNGENPPNPGPSPPSPIKPPTQCDSYYTCPESNTCCCLFEYGKYCFAWGCCPLEAATCCDDNYSCCPHEYPVCDLDQGTCLLSKNSPFSVKALKRKPATPFWSQGRKNIA at1g21750-at3g1939-1 At1g21750 interacts with At3g19390 761372 n/a 761376 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 761377 unspecified role unspecified role prey prey physical association physical association false false false Figure 7A Figure 7B at1g21750-at5g4306-1 At1g21750 interacts with At5g43060 761372 n/a 761376 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 761378 unspecified role unspecified role prey prey physical association physical association false false false Figure 7A Figure 7B at1g21750-rd21a-1 At1g21750 interacts with RD21A 761372 n/a 761376 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 761379 unspecified role unspecified role prey prey physical association physical association false false false Figure 7A Figure 7B at1g21750-rd21a At1g21750 interacts with RD21A 761373 n/a 761379 unspecified role unspecified role prey prey n/a 761376 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false at1g21750-at5g43060 At1g21750 interacts with At5g43060 761373 n/a 761376 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 761378 unspecified role unspecified role prey prey physical association physical association false false false at1g21750-at3g19390 At1g21750 interacts with At3g19390 761373 n/a 761376 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 761377 unspecified role unspecified role prey prey physical association physical association false false false at1g21750-rd21a-2 At1g21750 interacts with RD21A 761374 n/a 761376 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) n/a 761379 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 7C at1g21750-at5g4306-2 At1g21750 interacts with At5g43060 761374 n/a 761378 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761376 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 7C at1g21750-rd21a-3 At1g21750 colocalises with RD21A 761375 n/a 761376 unspecified role unspecified role neutral component neutral component n/a 761379 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Figure 8