IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lorkovic-2008-2 Co-localisation studies of Arabidopsis SR splicing factors reveal different types of speckles in plant cell nuclei. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Lorkovic ZJ., Hilscher J., Barta A. The authors inform us that "because all SR proteins are RNA binding proteins, protein extracts used for pull-downs and immunoprecipitations were treated with RNase A to avoid indirect, RNA-mediated interactions". zdravko.lorkovic@meduniwien.ac.at Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation lorkovic-2008-1 Co-localisation studies of Arabidopsis SR splicing factors reveal different types of speckles in plant cell nuclei. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Lorkovic ZJ., Hilscher J., Barta A. The authors inform us that "because all SR proteins are RNA binding proteins, protein extracts used for pull-downs and immunoprecipitations were treated with RNase A to avoid indirect, RNA-mediated interactions". zdravko.lorkovic@meduniwien.ac.at Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation lorkovic-2008-3 Co-localisation studies of Arabidopsis SR splicing factors reveal different types of speckles in plant cell nuclei. tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lorkovic ZJ., Hilscher J., Barta A. The authors inform us that "because all SR proteins are RNA binding proteins, protein extracts used for pull-downs and immunoprecipitations were treated with RNase A to avoid indirect, RNA-mediated interactions". zdravko.lorkovic@meduniwien.ac.at Exp. Cell Res. (0014-4827) 2008 Only protein-protein interactions imex curation rsz21_arath Serine/arginine-rich splicing factor RSZ21 RSZ21 RS-containing zinc finger protein 21 RSZP21 SRZ21 T23E23.2 At1g23860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTRVYVGNLDPRVTERELEDEFKAFGVLRNVWVARRPPGYAFLEFDDERDALDAISALDRKNGWRVELSHKDKGGRGGGGGRRGGIEDSKCYECGELGHFARECRRGRGSVRRRSPSPRRRRSPDYGYARRSISPRGRRSPPRRRSVTPPRRGRSYSRSPPYRGSRRDSPRRRDSPYGRRSPYANGV sr34_arath Serine/arginine-rich-splicing factor SR34 SR34 Pre-mRNA-splicing factor SF2 SF2 SR1 SR1 protein SRP34 F22D16.16 F22D16_30 At1g02840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRSSRTVYVGNLPGDIREREVEDLFSKYGPVVQIDLKVPPRPPGYAFVEFDDARDAEDAIHGRDGYDFDGHRLRVELAHGGRRSSDDTRGSFNGGGRGGGRGRGDGGSRGPSRRSEFRVLVTGLPSSASWQDLKDHMRKGGDVCFSQVYRDARGTTGVVDYTCYEDMKYALKKLDDTEFRNAFSNGYVRVREYDSRKDSRSPSRGRSYSKSRSRSRGRSVSRSRSRSRSRSRSPKAKSSRRSPAKSTSRSPGPRSKSRSPSPRRSRSRSRSPLPSVQKEGSKSPSKPSPAKSPIHTRSPSR src28_arath Serine/arginine-rich SC35-like splicing factor SCL28 SCL28 28 kDa SC35-like splicing factor SC35-like splicing factor 28 Serine/arginine-rich splicing factor 28 F17K4.60 At5g18810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARARSRSRSYSPRPRDRSPPRERKGYDDNRLRERPSSRDHESSGPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAEDAAEAMKRMNHKVIGGREIAIVFAEENRKTPQEMRTTNGTSGRHGDYKRTSHRSPRRRYRSHSRSRSPPRRESRHSKVREDDLYSPRRRSRSISRSPLPRNEREYKSRNCRSPREERVLTPIRSRCLSRSRSRSLSR sl30a_arath Serine/arginine-rich SC35-like splicing factor SCL30A SCL30A SC35-like splicing factor 30A Serine/arginine-rich splicing factor 30A K20M4.1 At3g13570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGRSYTPSPPRGYGRRGRSPSPRGRFGGSRDSDLPTSLLVRNLRHDCRQEDLRRPFEQFGPVKDIYLPRDYYTGDPRGFGFIQFMDPADAAEAKHQMDGYLLLGRELTVVFAEENRKKPTEMRTRDRGGRSNRFQDRRRSPPRYSRSPPPRRGRRSRSRSRGYNSPPAKRHQSRSVSPQDRRYEKERSYSRSPPHNGSRVRSGSPGRVKSHSRSPRRSVSPRKNRSYTPEQARSQSPVPRQSRSPTPVPRGAQNGDRSPSQ src30_arath Serine/arginine-rich SC35-like splicing factor SCL30 SCL30 SC35-like splicing factor 30 Serine/arginine-rich splicing factor 30 T22E16.120 At3g55460 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRRYSPPYYSPPRRGYGGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDVYIPRDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVASESRKRPEEMRVKTRTRSREPSGSRDRSHGRSRSRSISRSRSPRRPSDSRSRYRSRSYSPAPRRRGGPPRGEEDENYSRRSYSPGYEGAAAAAPDRDRNGDNEIREKPGYEAEDRRRGGRAVSRSPSGSRSRSVEVSPR sr30_arath Serine/arginine-rich splicing factor SR30 SR30 SF2/ASF-like splicing modulator Srp30 SRP30 Serine-arginine rich RNA binding protein 30 T12M4.19 At1g09140 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSRWNRTIYVGNLPGDIRKCEVEDLFYKYGPIVDIDLKIPPRPPGYAFVEFEDPRDADDAIYGRDGYDFDGCRLRVEIAHGGRRFSPSVDRYSSSYSASRAPSRRSDYRVLVTGLPPSASWQDLKDHMRKAGDVCFSEVFPDRKGMSGVVDYSNYDDMKYAIRKLDATEFRNAFSSAYIRVREYESRSVSRSPDDSKSYRSRSRSRGPSCSYSSKSRSVSPARSISPRSRPLSRSRSLYSSVSRSQSRSKSRSRSRSNSPVSPVISG rsz33_arath Serine/arginine-rich splicing factor RS2Z33 RS2Z33 RS-containing zinc finger protein 33 RSZ33 F3G5.13 At2g37340 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPRYDDRYGNTRLYVGRLSSRTRTRDLERLFSRYGRVRDVDMKRDYAFVEFGDPRDADDARHYLDGRDFDGSRITVEFSRGAPRGSRDFDSRGPPPGAGRCFNCGVDGHWARDCTAGDWKNKCYRCGERGHIERNCKNSPKKLRRSGSYSRSPVRSRSPRRRRSPSRSLSRSRSYSRSRSPVRRRERSVEERSRSPKRMDDSLSPRARDRSPVLDDEGSPKIIDGSPPPSPKLQKEVGSDRDGGSPQDNGRNSVVSPVVGAGGDSSKEDRSPVDDDYEPNRTSPRGSESP rsz22_arath Serine/arginine-rich splicing factor RSZ22 RSZ22 RS-containing zinc finger protein 22 RSZP22 SRZ22 F28M20.230 At4g31580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSRVYVGNLDPRVTERELEDEFRAFGVVRSVWVARRPPGYAFLDFEDPRDARDAIRALDGKNGWRVEQSHNRGERGGGGRGGDRGGGGGGRGGRGGSDLKCYECGETGHFARECRNRGGTGRRRSKSRSRTPPRYRRSPSYGRRSYSPRARSPPPPRRRSPSPPPARGRSYSRSPPPYRAREEVPYANGNGLKERRRSRS ru17_arath U1 small nuclear ribonucleoprotein 70 kDa RNU1 T3A5.50 At3g50670 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGDSGDPFLRNPNAAVQARAKVQNRANVLQLKLMGQSHPTGLTNNLLKLFEPRPPLEYKPPPEKRKCPPYTGMAQFVSNFAEPGDPEYAPPKPEVELPSQKRERIHKLRLEKGVEKAAEDLKKYDPNNDPNATGDPYKTLFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAAYKQADGQKIDGRRVLVDVERGRTVPNWRPRRLGGGLGTSRVGGGEEIVGEQQPQGRTSQSEEPSRPREEREKSREKGKERERSRELSHEQPRERSRDRPREDKHHRDRDQGGRDRDRDSRRDRDRTRDRGDRDRRDRDRGRDRTSRDHDRDRSRKKERDYEGGEYEHEGGGRSRERDAEYRGEPEETRGYYEDDQGDTDRYSHRYDKMEEDDFRYEREYKRSKRSESREYVR src33_arath Serine/arginine-rich SC35-like splicing factor SCL33 SCL33 SC35-like splicing factor 33 SR33 Serine/arginine-rich splicing factor 33 F7A10.15 At1g55310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGRSYTPSPPRGYGRRGRSPSPRGRYGGRSRDLPTSLLVRNLRHDCRQEDLRKSFEQFGPVKDIYLPRDYYTGDPRGFGFVQFMDPADAADAKHHMDGYLLLGRELTVVFAEENRKKPTEMRARERGGGRFRDRRRTPPRYYSRSRSPPPRRGRSRSRSGDYYSPPPRRHHPRSISPREERYDGRRSYSRSPASDGSRGRSLTPVRGKSRSLSPSPRRSISRSPRRSRSPSPKRNRSVSPRRSISRSPRRSRSPRRSRRSYTPEPARSRSQSPHGGQYDEDRSPSQ q9fyb1_arath sc35 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSHFGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEKISKGRVVEPPPKSRRSRSRSPRRSRSPRRSRSPPRRRSPRRSRSPRRRSRDDYREKDYRKRSRSRSYDRRERHEEKDRDHRRRTRSRSASPDEKRRVRGRYDNESRSHSRSLSASPARRSPRSSSPQKTSPAREVSPDKRSNERSPSPRRSLSPRSPALQKASPSKDMSPERRSNERSPSPGSPAPLRKVDAASRSQSPYAAE srs31_arath Serine/arginine-rich splicing factor RS31 RS31 RSP31 F21F14.30 At3g61860 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPVFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLDNFPFGYEKRRLSVEWAKGERGRPRGDAKAPSNLKPTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRNFSFVQFETQEDATKALEATQRSKILDRVVSVEYALKDDDERDDRNGGRSPRRSLSPVYRRRPSPDYGRRPSPGQGRRPSPDYGRARSPEYDRYKGPAAYERRRSPDYGRRSSDYGRQRSPGYDRYRSRSPVPRGRP rszp21-sf2 RSZp21 interacts with SF2 (RSZp34) 761415 N/A-x-x 761418 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761419 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8A scl28-scl30a-1 SCL28 interacts with SCL30a 761415 N/A 761420 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 761421 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B scl28-scl30-1 SCL28 interacts with SCL30 761415 N/A 761422 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 761420 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl28 SCL28 homodimer 761415 N/A-x-x-x-x-x 761420 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 761420 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B scl28-sf2 SCL28 interacts with SF2 (Rsp34) 761415 n/a 761419 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A 761420 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl28-srp30 SCL28 interacts with Srp30 761415 N/A 761420 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 761423 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B scl28-rszp21 SCL28 interacts with RSZp21 761415 N/A 761418 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast N/A-x-x-x 761420 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl30-scl28 SCL30 interacts with SCL28 761415 n/a 761422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761420 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B scl30-3 SCL30 homodimer 761415 n/a 761422 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 761422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl30-scl30a-3 SCL30 interacts with SCL30a 761415 n/a 761421 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 761422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl30-rszp21 SCL30 interacts with RSZp21 761415 n/a 761418 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 761422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl30-srp30 SCL30 interacts with Srp30 761415 n/a 761422 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761423 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B scl30-sf2-1 SCL30 interacts with SF2 (RSZp34) 761415 n/a 761419 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 761422 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl30a-scl28 SCL30a interacts with SCL28 761415 n/a 761421 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761420 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B scl30a-1 SCL30a homodimer 761415 n/a 761421 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761421 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B scl30a-sf2 SCL30a interacts with SF2 (Rsp34) 761415 n/a 761419 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 761421 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl30a-srp30-1 SCL30a interacts with Srp30 761415 n/a 761423 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 761421 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B scl30a-rszp21 SCL30a interacts with RSZp21 761415 n/a 761418 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast n/a 761421 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8B sc30a-scl30 SCL30a interacts with SCL30 761415 n/a 761421 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761422 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8B rsz33-sf2-2 RSZ33 interacts with SF2( RSZp34) 761415 n/a 761424 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 761419 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association false false false Figure 8A rszp21-rszp22 RSZp21 colocalises with RSZp22 761416 n/a 761425 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761418 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 1B Co-expression of RSZp21-GFP and RSZp22-RFP also resulted in their complete co-localisation in nuclear speckles. rszp21-rszp33 RSZp21 colocalises with RSZp33 761416 N/A 761424 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761418 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 1B Co-expression of RSZp21-GFP and RSZp33-RFP also resulted in their complete co-localisation in nuclear speckles. rszp22-rszp33 RSZp22 colocalises with RSZp33 761416 N/A-x 761424 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 761425 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 1C Co-expression of RSZp22-GFP and RSZp33-RFP also resulted in their complete co-localisation in nuclear speckles. sf2-rnu1 SF2 (SRp34) colocalises with RNU1 (U1 snRNP-specific protein 70K) 761416 N/A 761426 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 761419 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 3B However, co-expression of SRp34-RFP with the U1 snRNP-specific protein 70K fused to GFP, another protein pair known to interact in vitro and in vivo [26,31], resulted in their precise co-localisation as reported previously Proteins colocalised within nuclear speckles. rsz33-rnu1-1 RSZ33 partially colocalises with RNU1 (U1 snRNP-specific protein 70K) 761416 N/A 761424 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761426 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 3C Proteins were shown to partially colocalise within nuclear speckles. rsz33-scl28 RSZ33 partially colocalises with SCL28 761416 N/A 761424 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761420 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false The authors state that "co-expression of RSZ33-GFP with SCL28, SCL30, and SCL30a fused to RFP resulted in their partial co-localisation", however do not show the data in the case of SCL28 / RSZ33 colocalisation. rsz33-scl30 RSZ33 partially colocalises with SCL30 761416 N/A 761422 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761424 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4A The proteins partially colocalised to nuclear speckles. rsz33-scl30a RSZ33 partially colocalises with SCL30a 761416 N/A-x-x 761424 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761421 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 4C The proteins partially colocalised to nuclear speckles. scl28-scl30 SCL28 colocalises with SCL30 761416 N/A 761420 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761422 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 5A The proteins partially colocalised to nuclear speckles. scl28-scl33 SCL28 colocalises with SCL33 761416 N/A 761427 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761420 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 5A The proteins partially colocalised to nuclear speckles. sc35-scl28 SC35 colocalises with SCL28 761416 N/A 761428 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761420 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 5B sc35-scl30 SC35 colocalises with SCL30 761416 N/A 761422 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761428 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 5B sc35-scl30a SC35 colocalises with SCL30a 761416 N/A 761428 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761421 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 5B sc35-rsz33 SC35 colocalises with RSZ33 761416 N/A 761424 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761428 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 6 Proteins were shown to colocalise within nuclear speckles. sc35-sf2 SC35 partially colocalises with SF2 (RSZ34) 761416 N/A-x 761428 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 761419 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 7 Proteins were shown to partially colocalise within nuclear speckles. rsp31-scl30a RSP31 colocalises with SCL30a 761416 N/A 761421 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761429 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 7B rsp31-scl30 RSP31 colocalises with SCL30 761416 N/A-x 761429 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761422 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 7B scl30-scl30a-2 SCL30 colocalises with SCL30a 761416 N/A 761422 unspecified role unspecified role neutral component neutral component c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A-x 761421 unspecified role unspecified role neutral component neutral component c-terminal rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false colocalization colocalization false false false Figure 5A The proteins partially colocalised to nuclear speckles. scl33-scl28 SCL33 interacts with SCL28 761417 N/A 761427 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761420 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 8C scl33-scl30 SCL33 interacts with SC30 761417 N/A 761427 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761422 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 8C scl33 SCL33 homodimer 761417 N/A 761427 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761427 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 8C sc35-scl30-1 SC35 interacts with SCL30 761417 N/A 761422 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 761428 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 8D sc35-scl30a-1 SC35 interacts with SCL30a 761417 N/A 761428 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 761421 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 8D sc35-scl33 SC35 interacts with SCL33 761417 N/A 761427 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A-x-x 761428 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 8D