IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ steffen-2008-1 AGL61 Interacts with AGL80 and Is Required for Central Cell Development in Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Steffen JG., Kang IH., Portereiko MF., Lloyd A., Drews GN. drews@bioscience.utah.edu Plant Physiol. (0032-0889) 2008 agl80_arath Agamous-like MADS-box protein AGL80 At5g48670 AGL80 FEM111 K15N18.16 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTRKKVKLAYISNDSSRKATFKKRKKGLMKKVHELSTLCGITACAIIYSPYDTNPEVWPSNSGVQRVVSEFRTLPEMDQHKKMVDQEGFLKQRIAKATETLRRQRKDSRELEMTEVMFQCLIGNMEMFHLNIVDLNDLGYMIEQYLKDVNRRIEILRNSGTEIGESSSVAVAASEGNIPMPNLVATTAPTTTIYEVGSSSSFAAVANFVNPIDLQQFRHPAAQHVGLNEQPQNLNLNLNQNYNQNQEWFMEMMNHPEQMRYQTEQMGYQFMDDNHHNHIHHQPQEHQHQIHDESSNALDAANSSSIIPVTSSSITNKTWFH agl61_arath Agamous-like MADS-box protein AGL61 At2g24840 AGL61 DIA Protein DIANA F27C12.24 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYVTKYKNKLPTLQVDLIIMPHQTQACIYKQTLSLHQIFQQRKATKTLHTKKTMMSKKKESIGRQKIPMVKIKKESHRQVTFSKRRAGLFKKASELCTLCGAEIGIIVFSPAKKPFSFGHPSVESVLDRYVSRNNMSLAQSQQLQGSPAASCELNMQLTHILSEVEEEKKKGQAMEEMRKESVRRSMINWWEKPVEEMNMVQLQEMKYALEELRKTVVTNMASFNEAKDDVFGFLDNKVTVPPYVNMPSGPSNIYNFANGNGCF agl80-agl61 AGL80 (At5g48670) interacts with AGL61 (At2g24840) 764910 N/A 764911 unspecified role unspecified role bait bait N/A 764912 unspecified role unspecified role prey prey physical association physical association false false false Figure 5 agl61-agl80 AGL61 (At2g24840) interacts with AGL80 (At5g48670) 764910 N/A-x 764912 unspecified role unspecified role bait bait N/A-x 764911 unspecified role unspecified role prey prey physical association physical association false false false Figure 5