IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bush-2008-2 The Prader-Willi syndrome protein necdin interacts with the E1A-like inhibitor of differentiation EID-1 and promotes myoblast differentiation. mouse-c2c12 Mouse C3H muscle myoblast c2c12 Mouse C3H muscle myoblast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bush JR., Wevrick R. Transcriptional regulators can create false positives in nuclear yeast two hybrid system. Hence, the CytoTrap library system is based on cytoplasmic interactions that activate the Ras signaling system, inducing cell growth was used.. rachel.wevrick@ualberta.ca fetal brain cDNA Differentiation (0301-4681) 2008 Only protein-protein interactions imex curation bush-2008-1 The Prader-Willi syndrome protein necdin interacts with the E1A-like inhibitor of differentiation EID-1 and promotes myoblast differentiation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Bush JR., Wevrick R. Transcriptional regulators can create false positives in nuclear yeast two hybrid system. Hence, the CytoTrap library system is based on cytoplasmic interactions that activate the Ras signaling system, inducing cell growth was used.. rachel.wevrick@ualberta.ca fetal brain cDNA Differentiation (0301-4681) 2008 Only protein-protein interactions imex curation bush-2008-3 The Prader-Willi syndrome protein necdin interacts with the E1A-like inhibitor of differentiation EID-1 and promotes myoblast differentiation. mouse-gt1_7 Mus musculus hypothalamic cell line, GT1-7 gt1_7 mouse hypothalamic cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Bush JR., Wevrick R. Transcriptional regulators can create false positives in nuclear yeast two hybrid system. Hence, the CytoTrap library system is based on cytoplasmic interactions that activate the Ras signaling system, inducing cell growth was used.. rachel.wevrick@ualberta.ca fetal brain cDNA Differentiation (0301-4681) 2008 Only protein-protein interactions imex curation bush-2008-4 The Prader-Willi syndrome protein necdin interacts with the E1A-like inhibitor of differentiation EID-1 and promotes myoblast differentiation. mouse-gt1_7 Mus musculus hypothalamic cell line, GT1-7 gt1_7 mouse hypothalamic cell line anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Bush JR., Wevrick R. Transcriptional regulators can create false positives in nuclear yeast two hybrid system. Hence, the CytoTrap library system is based on cytoplasmic interactions that activate the Ras signaling system, inducing cell growth was used.. rachel.wevrick@ualberta.ca fetal brain cDNA Differentiation (0301-4681) 2008 Only protein-protein interactions imex curation necd_mouse Necdin Ndn protein protein mouse Mus musculus Mouse MSEQSKDLSDPNFAAEVPDCEMQDSDAVPVGIPPPASLAANLAGPPCAPEGPMAAQQASPPPEERIEDVDPKILQQAAEEGRAHQPQSPARPIPAPPAPAQLVQKAHELMWYVLVKDQKRMVLWFPDMVKEVMGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDRVALNNRMPMTGLLLMILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTFGDVRKIITEEFVQQNYLKYQRVPHIEPPEYEFFWGSRANREITKMQIMEFLARVFKKDPQAWPSRYREALEQARALREANLAAQAPRSSVSED eid1_human EP300-interacting inhibitor of differentiation 1 EID1 C15orf3 CRI1 RBP21 PNAS-22 PTD014 E1A-like inhibitor of differentiation 1 CREBBP/EP300 inhibitory protein 1 21 kDa pRb-associated protein protein protein human Homo sapiens Human MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE ndn-eid1-1 761113 N/A 761117 unspecified role unspecified role prey prey xpress tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 761118 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A ndn-eid1-2 761113 N/A 761117 unspecified role unspecified role bait bait xpress tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 761118 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1A ndn-eid1 761114 N/A 761118 unspecified role unspecified role prey prey N/A 761117 unspecified role unspecified role bait bait physical association physical association false false false ndn-eid1-3 761115 N/A 761118 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 761117 unspecified role unspecified role prey prey physical association physical association false false false 1B ndn-eid1-4 761116 N/A-x-x-x-x 761117 unspecified role unspecified role bait bait N/A-x-x-x-x 761118 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 1B