UniProt UniProt http://www.uniprot.org ohbayashi-2008-1 An RNA biding protein, Y14 interacts with and modulates STAT3 activation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Ohbayashi N., Taira N., Kawakami S., Togi S., Sato N., Ikeda O., Kamitani S., Muromoto R., Sekine Y., Matsuda T. tmatsuda@pharm.hokudai.ac.jp mouse 11-day embryo MATCHMAKER cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation ohbayashi-2008-2 An RNA biding protein, Y14 interacts with and modulates STAT3 activation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. pull down pull down anti tag western anti tag western blot anti tag western Ohbayashi N., Taira N., Kawakami S., Togi S., Sato N., Ikeda O., Kamitani S., Muromoto R., Sekine Y., Matsuda T. tmatsuda@pharm.hokudai.ac.jp mouse 11-day embryo MATCHMAKER cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation ohbayashi-2008-3 An RNA biding protein, Y14 interacts with and modulates STAT3 activation. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ohbayashi N., Taira N., Kawakami S., Togi S., Sato N., Ikeda O., Kamitani S., Muromoto R., Sekine Y., Matsuda T. tmatsuda@pharm.hokudai.ac.jp mouse 11-day embryo MATCHMAKER cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation ohbayashi-2008-4 An RNA biding protein, Y14 interacts with and modulates STAT3 activation. human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). confocal microscopy confocal microscopy immunostaining immunostaining Ohbayashi N., Taira N., Kawakami S., Togi S., Sato N., Ikeda O., Kamitani S., Muromoto R., Sekine Y., Matsuda T. Transfected Hep3B cells have been treated with or without IL-6. tmatsuda@pharm.hokudai.ac.jp mouse 11-day embryo MATCHMAKER cDNA Biochem. Biophys. Res. Commun. (0006-291X) 2008 Only protein-protein interactions imex curation rbm8a_mouse RNA-binding protein 8A Rbm8a Rbm8 RNA-binding motif protein 8A Ribonucleoprotein RBM8A protein protein mouse Mus musculus Mouse MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D rbm8a_human RNA-binding protein 8A HSPC114 MDS014 RNA-binding motif protein 8A Ribonucleoprotein RBM8A RNA-binding protein Y14 Binder of OVCA1-1 RBM8A RBM8 protein protein human Homo sapiens Human MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR stat3-rbm8a 767077 n/a 767081 unspecified role unspecified role prey prey n/a 767082 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false The authors do not specify the species of the sequence of STAT3 used. The protein they use is 750 residues but the human protein (and mouse) is 770 residues. It is inferred that the protein is human as they are working with human cell lines. The authors report a (deduced) length of 204 aa for the Rbm8a/Y14 protein, however the mouse (and human) protein comprises 174 aa. no figure stat3-rbm8a-1 767078 n/a 767083 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 767082 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false The authors do not specify the species of the sequence of STAT3 used. The protein they use is 750 residues but the human protein (and mouse) is 770 residues. It is inferred that the potein is human as they are working with human cell lines. 1B stat3-rbm8a-2 767079 n/a 767082 unspecified role unspecified role bait bait human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. n/a 767083 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association false false false The authors do not specify the species of the sequence of STAT3 used. The protein they use is 750 residues but the human protein (and mouse) is 770 residues. It is inferred that the potein is human as they are working with human cell lines. 1C RBM8A/Y14 interacts with STAT3 without LIF stimulation, although STAT3 was tyrosine-phosphorylated by LIF stimulation, indicating that binding of Y14 to STAT3 occurs independently of activation of STAT3. An inactive form of STAT3, STAT3 YF mutant (not further specified by the authors), bound to Y14 like wild-type STAT3 did, indicating that unphosphorylated and monomer STAT3 can interact with Y14. stat3-rbm8a-3 767080 n/a 767083 unspecified role unspecified role neutral component neutral component human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). n/a 767082 unspecified role unspecified role neutral component neutral component human-hep_3b Homo sapiens hepatocellular carcinoma (HCC) cells (p53-null). hep_3b human hepatocellular carcinoma (HCC) cells (p53-null). colocalization colocalization false false false The authors do not specify the species of the sequence of STAT3 used. The protein they use is 750 residues but the human protein (and mouse) is 770 residues. It is inferred that the potein is human as they are working with human cell lines. 1D Colocalization in the nucleus occurs upon stimulation with Il-6.