IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ anderson-2008-1 Arabidopsis thaliana Y-family DNA polymerase eta catalyses translesion synthesis and interacts functionally with PCNA2. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Anderson HJ., Vonarx EJ., Pastushok L., Nakagawa M., Katafuchi A., Gruz P., Di Rubbo A., Grice DM., Osmond MJ., Sakamoto AN., Nohmi T., Xiao W., Kunz BA. bkunz@deakin.edu.au Plant J. (0960-7412) 2008 anderson-2008-2 Arabidopsis thaliana Y-family DNA polymerase eta catalyses translesion synthesis and interacts functionally with PCNA2. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Anderson HJ., Vonarx EJ., Pastushok L., Nakagawa M., Katafuchi A., Gruz P., Di Rubbo A., Grice DM., Osmond MJ., Sakamoto AN., Nohmi T., Xiao W., Kunz BA. bkunz@deakin.edu.au Plant J. (0960-7412) 2008 pcna1_arath Proliferating cellular nuclear antigen 1 PCNA PCNA1 F22G5.29 At1g07370 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLELRLVQGSLLKKVLESIKDLVNDANFDCSSTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGGDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSNEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMKEPVSLSFALRYMNSFTKATPLSDTVTISLSSELPVVVEYKVAEMGYIRYYLAPKIEEEEDTNP polh_arath DNA polymerase eta POLH RAD30 Radiation-sensitive protein 30 Y-family DNA polymerase H K23L20.8 T19K24.15 At5g44740 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVARPEASDARVIAHVDMDCFYVQVEQRKQPELRGLPSAVVQYNEWQGGGLIAVSYEARKCGVKRSMRGDEAKAACPQIQLVQVPVARGKADLNLYRSAGSEVVSILAKSGKCERASIDEVYLDLTDAAESMLADAPPESLELIDEEVLKSHILGMNREDGDDFKESVRNWICREDADRRDKLLSCGIIIVAELRKQVLKETEFTCSAGIAHNKMLAKLASGMNKPAQQTVVPYAAVQELLSSLPIKKMKQLGGKLGTSLQTDLGVDTVGDLLQFSETKLQEHYGVNTGTWLWNIARGISGEEVQGRLLPKSHGSGKTFPGPRALKSLSTVQHWLNQLSEELSERLGSDLEQNKRIASTLTLHASAFRSKDSDSHKKFPSKSCPMRYGVTKIQEDAFNLFQAALREYMGSFGIKPQGNKLETWRITGLSVSASKIVDIPSGTSSIMRYFQSQPTVPSRSADGCVQGNVAMTASASEGCSEQRSTETQAAMPEVDTGVTYTLPNFENQDKDIDLVSEKDVVSCPSNEATDVSTQSESNKGTQTKKIGRKMNNSKEKNRGMPSIVDIFKNYNATPPSKQETQEDSTVSSASKRAKLSSSSHNSQVNQEVEESRETDWGYKTDEIDQSVFDELPVEIQRELRSFLRTNKQFNTGKSKGDGSTSSIAHYFPPLNR pcna2_arath Proliferating cell nuclear antigen 2 PCNA2 F16P2.5 At2g29570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLELRLVQGSLLKKVLEAVKDLVNDANFDCSTTGFSLQAMDSSHVALVSLLLRSEGFEHYRCDRNLSMGMNLGNMSKMLKCAGNDDIITIKADDGSDTVTFMFESPTQDKIADFEMKLMDIDSEHLGIPDAEYHSIVRMPSGEFSRICKDLSSIGDTVVISVTKEGVKFSTAGDIGTANIVLRQNTTVDKPEDAIVIEMNEPVSLSFALRYMNSFTKATPLSETVTISLSSELPVVVEYKVAEMGYIRYYLAPKIEEEEDTKPE polh_yeast DNA polymerase eta RAD30 DBH1 YDR419W Radiation-sensitive protein 30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDPVVCVQWNSIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGEDFWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVERASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYDINSHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRDSIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKFEITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKVKQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKNLRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTKSYEVYRKSGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLSMTITNFDIIDLQKTVVDMFGNQVHTFKSSAGKEDEEKTTSSKADEKTPKLECCKYQVTFTDQKALQEHADYHLALKLSEGLNGAEESSKNLSFGEKRLLFSRKRPNSQHTATPQKKQVTSSKNILSFFTRKK CFB1A9FBC8AFE39B pcna_yeast Proliferating cell nuclear antigen YBR0811 YBR088C POL30 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSLEIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMDQPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPKFNDEE 9B56C5851621DDDC at5g44740-pcna1 At5g44740 (POLH) interacts with PCNA1 765101 N/A 765103 unspecified role unspecified role prey prey N/A 765104 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a at5g44740-pcna2 At5g44740 (POLH) interacts with PCNA2 765101 N/A 765105 unspecified role unspecified role prey prey N/A 765104 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a rad30-pcna2 RAD30 interacts with PCNA2 765101 N/A 765105 unspecified role unspecified role prey prey N/A 765106 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a rad30-pcna1 RAD30 interacts with PCNA1 765101 N/A 765103 unspecified role unspecified role prey prey N/A 765106 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a rad30-pol30 RAD30 interacts with Pol30 765101 N/A 765106 unspecified role unspecified role bait bait N/A 765107 unspecified role unspecified role prey prey physical association physical association false false false Figure 4a at5g44740-pol30-1 At5g44740 (POLH) interacts with Pol30 765101 N/A 765104 unspecified role unspecified role bait bait N/A-x 765107 unspecified role unspecified role prey prey physical association physical association false false false Figure 4a pcna2-at5g44740 PCNA2 interacts with At5g44740 (POLH) 765102 N/A-x 765104 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A-x 765105 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4b pcna1-at5g44740 PCNA1 interacts with At5g44740 (POLH) 765102 N/A-x 765103 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A-x 765104 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 4b