IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ lin-2008-2 USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Lin CH., Chang HS., Yu WC. The positive control interaction (p53-SV40 T) was not curated as the source of p53 is not found in the text of the paper. hschang@mail.ncku.edu.tw A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation lin-2008-4 USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation lin-2008-1 USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation lin-2008-3 USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. human-h1299 Homo sapiens lung lymph node carcinoma h1299 Human lung lymph node carcinoma p53 null. These cells have also been reported to secrete the peptide hormone neuromedin B (NMB), but not gastrin releasing peptide (GRP). Also known as NCI H1299 or CRL-5803. http://www.lgcpromochem.com/atcc/ ATCC number: CRL-5803. ATCC number of the cell line is CRL-5803. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation lin-2008-5 USP11 stabilizes HPV-16E7 and further modulates the E7 biological activity. human-caski Homo sapiens CaSki caski Human cervical carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lin CH., Chang HS., Yu WC. hschang@mail.ncku.edu.tw A HeLa-S3 cDNA library was used. J. Biol. Chem. (0021-9258) 2008 Only protein-protein interactions imex curation ubp11_human Ubiquitin carboxyl-terminal hydrolase 11 USP11 UHX1 Ubiquitin-specific-processing protease 11 Deubiquitinating enzyme 11 Ubiquitin thioesterase 11 protein protein human Homo sapiens Human MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRRERTAMATVAANPAAAAAAVAAAAAVTEDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDEDFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAEAYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVKKKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDPFCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERMMVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPARDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVTKPNSDDEDDGDEKEDDEEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQTVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVRLQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREKLDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQWHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACSSPPSSEFMDVN ve7_hpv16 Protein E7 E7 protein protein hpv16 Human papillomavirus type 16 MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP ve7_hpv18 Protein E7 E7 protein protein hpv18 Human papillomavirus type 18 MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARIKLVVESSADDLRAFQQLFLNTLSFVCPWCASQQ e7-usp11-1 HPV-16E7 and USP11 interact in a directed yeast two-hybrid assay 739346 N/A 739351 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 739352 unspecified role unspecified role bait bait physical association physical association false false false The authors state that intact HPV-16E7 was used and give the range as aa 1-97. However, the length of the UniProtKB entry for this protein is 98 aa. A C-terminal region of USP11 bound to HPV-16E7. However, the authors do not specify the range. 1 e7-usp11-2 HPV-18E7 and USP11 interact in a directed yeast two-hybrid assay 739346 N/A 739351 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 739353 unspecified role unspecified role bait bait physical association physical association false false false A C-terminal region of USP11 bound to HPV-18E7. However, the authors do not specify the range. 1 e7-usp11-4 HPV-16E7 coimmunoprecipitates USP11 in H1299 cells 739347 N/A 739351 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 739352 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 B P03129; P51784 transfection e7-usp11-6 HPV-16E7 coimmunoprecipitates USP11 in H1299 cells 739347 N/A 739352 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 739351 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false S4 A e7-usp11 HPV-16E7 and USP11 interact in a yeast two-hybrid assay 739348 N/A 739351 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind c-term range C-terminal range c-term range c-term range C-terminal range c-term range false N/A 739352 unspecified role unspecified role bait bait physical association physical association false false false The authors state that intact HPV-16E7 was used and give the range as aa 1-97. However, the length of the UniProtKB entry for this protein is 98 aa. A C-terminal region of USP11 bound to HPV-16E7. However, the authors do not specify the range. e7-usp11-3 HPV-16E7 coimmunoprecipitates USP11 in H1299 cells 739349 N/A 739351 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 739352 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 2 A P51784; P03129 transfection e7-usp11-5 Endogenous HPV-16E7 coimmunoprecipitates endogenous USP11 in CaSki lysates 739350 N/A 739351 unspecified role unspecified role bait bait ecobb Escherichia coli (strain B / BL21) N/A 739352 unspecified role unspecified role prey prey in vitro In vitro physical association physical association false false false 2 D