MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint schrumpfova-2008-1 Mapping of interaction domains of putative telomere-binding proteins AtTRB1 and AtPOT1b from Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Schrumpfova P.P., Kuchar M., Palecek J., Fajkus J. fajkus@sci.muni.cz FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation schrumpfova-2008-2 Mapping of interaction domains of putative telomere-binding proteins AtTRB1 and AtPOT1b from Arabidopsis thaliana. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Schrumpfova P.P., Kuchar M., Palecek J., Fajkus J. fajkus@sci.muni.cz FEBS Lett. (0014-5793) 2008 Only protein-protein interactions imex curation trb1_arath Telomere repeat-binding factor 1 TRB1 MYB transcription factor F2J10.16 At1g49950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGAPKQKWTQEEESALKSGVIKHGPGKWRTILKDPEFSGVLYLRSNVDLKDKWRNMSVMANGWGSREKSRLAVKRTFSLPKQEENSLALTNSLQSDEENVDATSGLQVSSNPPPRRPNVRLDSLIMEAIATLKEPGGCNKTTIGAYIEDQYHAPPDFKRLLSTKLKYLTSCGKLVKVKRKYRIPNSTPLSSHRRKGLGVFGGKQRTSSLPSPKTDIDEVNFQTRSQIDTEIARMKSMNVHEAAAVAAQAVAEAEAAMAEAEEAAKEAEAAEAEAEAAQAFAEEASKTLKGRNICKMMIRA trb2_arath Telomere repeat-binding factor 2 TRB2 MYB transcription factor TBP3 Telomere-binding protein 3 K9I9.15 At5g67580 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGAPKQKWTPEEEAALKAGVLKHGTGKWRTILSDTEFSLILKSRSNVDLKDKWRNISVTALWGSRKKAKLALKRTPPGTKQDDNNTALTIVALTNDDERAKPTSPGGSGGGSPRTCASKRSITSLDKIIFEAITNLRELRGSDRTSIFLYIEENFKTPPNMKRHVAVRLKHLSSNGTLVKIKHKYRFSSNFIPAGARQKAPQLFLEGNNKKDPTKPEENGANSLTKFRVDGELYMIKGMTAQEAAEAAARAVAEAEFAITEAEQAAKEAERAEAEAEAAQIFAKAAMKALKFRIRNHPW trb3_arath Telomere repeat-binding factor 3 TRB3 MYB transcription factor TBP2 Telomere-binding protein 2 T16K5.200 At3g49850 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGAPKLKWTPEEETALKAGVLKHGTGKWRTILSDPVYSTILKSRSNVDLKDKWRNISVTALWGSRKKAKLALKRTPLSGSRQDDNATAITIVSLANGDVGGQQIDAPSPPAGSCEPPRPSTSVDKIILEAITSLKRPFGPDGKSILMYIEENFKMQPDMKRLVTSRLKYLTNVGTLVKKKHKYRISQNYMAEGEGQRSPQLLLEGNKENTPKPEENGVKNLTKSQVGGEVMIMGMTEKEAAAAAARAVAEAEFAMAEAEEAAREADKAEAEAEAAHIFAKAAMKAVKYRMHSQTR pot1b_arath Protection of telomeres protein 1b POT1B POT2 Protection of telomeres protein 2 MHF15 At5g06310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEERRDDYKFLRIQDAFKALHLHVNLIGVIVELGFSNGSDCSCTLKIVDPWYSGSGLPVKFVARTIRDLPRVESIGDIILLSRVKIVLINRKITALCNETTSSSFALFNGKHSVDSIPYQSSPKFLMREQDKNFLSNLREWMITYKFEDGSCCFTSLKDIKEGECSNLSCQIVHISKVYKDRWYLFVWDGTEMPPCNILVKSERLPLCVEPEMLPTYMLRKFPTFGSVLRIIVDRVSEKQAIHCLQPGQHVKLLNLFFQVNMGLWNATFTPSTKMQYTMSREMEAFSPQRMCGEKFSPRWNPIARCISRSHSEITGVAHDDAPFVSLMDILTYHNVTAKFRCVVRFIQVYPRDVRKLRDINGNIKLVAILEDATARIHASLYADEGEKFFGCDESDEEALVKKLNRLLGGEEMEKVPRNPPWVQCCLFSFYKHKMDQWESRRFRIFDTWINAS trb1-trb1-1 729266 n/a 729268 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 729268 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1A trb1-trb2-1 729266 n/a 729268 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 729269 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1A trb1-trb3-1 729266 n/a 729270 unspecified role unspecified role bait bait n/a 729268 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 1A atpot1b-trb2 729266 n/a 729271 unspecified role unspecified role prey prey n/a 729269 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2A atpot1b-trb3 729266 n/a 729271 unspecified role unspecified role prey prey n/a 729270 unspecified role unspecified role bait bait physical association physical association false false false Fig. 2A atpot1b-trb1-4 729266 n/a 729268 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 729271 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 729294 729292 physical association physical association false false false Fig. 2D trb1-trb2-2 729267 n/a 729268 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro n/a 729269 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro physical association physical association false false false Fig. 1B trb1-trb3 729267 n/a 729270 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 729268 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false Fig. 1B atpot1b-trb1-5 729267 n/a 729271 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 729268 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false in vitro In vitro physical association physical association false false false Fig. 2C