MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint winter-2008-1 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation winter-2008-2 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation winter-2008-3 14-3-3 proteins recognize a histone code at histone H3 and are required for transcriptional activation. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Winter S., Simboeck E., Fischle W., Zupkovitz G., Dohnal I., Mechtler K., Ammerer G., Seiser C. EMBO J. (0261-4189) 2008 2009-01-08 Only protein-protein interactions imex curation 1433z_mouse 14-3-3 protein zeta/delta Ywhaz Protein kinase C inhibitor protein 1 SEZ-2 protein protein mouse Mus musculus Mouse MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGEN h3_peptide-4 conserved AA 13-33 peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) GKAPRKQLATKAARKSAPATG An amino acid sequence which is not represented in UniProt 1433e_mouse 14-3-3 protein epsilon Ywhae protein protein mouse Mus musculus Mouse MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ hist1h3a-ywhaz 730937 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false F3 kd 35 micromolar mint hist1h3a-ywhaz-1 730937 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3 kd 61 micromolar mint hist1h3a-ywhaz-2 730937 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F3 kd 49 micromolar mint hist1h3a-ywhaz-3 730937 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3 kd 30 micromolar mint hist1h3a-ywhaz-4 730937 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false F3 kd 26 micromolar mint hist1h3a-ywhaz-5 730937 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false F3 kd 40 micromolar mint hist1h3a-ywhae 730937 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 1433e_mouse 14-3-3 protein epsilon 730942 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component in vitro translated in vitro translated protein in vitro translated gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3 kd 73 micromolar homomint mint hist1h3a-ywhaz-6 730937 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm direct interaction direct interaction false false false F3 kd 23 micromolar mint hist1h3a-ywhae-1 730937 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 1433e_mouse 14-3-3 protein epsilon 730942 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false F3 kd 55 micromolar homomint mint hist1h3a-ywhaz-7 730937 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified sumoylated lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false F3 kd 42 micromolar mint ywhaz-hist1h3a 730938 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false h31_mouse H3 730941 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association false false false F1A Induction of phosphoacetylation increases histone H3 interaction with 14-3-3. mint hist1h3a-ywhaz-8 730938 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F2A mint hist1h3a-ywhaz-9 730938 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F2A mint hist1h3a-ywhaz-10 730938 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumoylated lysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false F2A mint hist1h3a-ywhaz-11 730938 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F2A mint hist1h3a-ywhaz-12 730938 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified dimethyllysine n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm physical association physical association false false false F2A mint hist1h3a-ywhaz-13 730938 1433z_mouse 14-3-3 protein zeta 730940 western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm physical association physical association false false false F2B mint hist1h3a-ywhaz-14 730938 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified sumoylated lysine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 1433z_mouse 14-3-3 protein zeta 730940 polyclonal immunost polyclonal antibody immunostaining polyclonal immunost unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate physical association physical association false false false F2B mint hist1h3a-ywhaz-15 730939 h31_mouse H3 730941 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified selenocysteine ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm phosphorylated phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false 1433z_mouse 14-3-3 protein zeta 730940 predetermined predetermined participant predetermined unspecified role unspecified role prey prey in vitro translated in vitro translated protein in vitro translated physical association physical association false false false F2C mint