MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint niu-2007-1 Regulation of flowering time by the protein arginine methyltransferase AtPRMT10. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Niu L., Lu F., Pei Y., Liu C., Cao X. EMBO Rep. (1469-221X) 2007 2009-01-08 Only protein-protein interactions imex curation h2a1_bovin Histone H2A type 1 H2A.1b protein protein bovin Bos taurus (Bovine) Bovine MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKAKGK Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling mint anm10_arath Protein arginine N-methyltransferase PRMT10 PRMT10 PRMT4.2 F13M7.14 F13M7_12 At1g04870 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRSSQNGGAMGGRAAGTGGGGPSAPVDKEVDYAQYFCTYSFLYHQKDMLSDRVRMDAYFNAVFQNKHHFEGKTVLDVGTGSGILAIWSAQAGARKVYAVEATKMADHARALVKANNLDHIVEVIEGSVEDISLPEKVDVIISEWMGYFLLRESMFDSVISARDRWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMADWHNFSDEIKSYYGVDMGVLTKPFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTASVSEIEEVRSNVTSVINMEHTRLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHWGQQVFIMSNPINVEEGDNLNLGLLMSRSKENHRLMEIELNCEIKEASGNPKESFKKTYFIE h4_bovin Histone H4 H4.1 protein protein bovin Bos taurus (Bovine) Bovine MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling mint mbp_human Myelin basic protein MBP Myelin A1 protein Myelin membrane encephalitogenic protein protein protein human Homo sapiens Human MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR h2a1-prmt10 724501 h2a1_bovin H2A 724502 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified anm42_arath AtPRMT10 724503 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false methylation methylation reaction methylation false false false f2a mint h4-prmt10 724501 h4_bovin H4 724504 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region n-terminal n-terminal position amino-terminus n-terminus n-term n-term amino-terminus n-terminus n-terminal certain certain sequence position certain false undefined mutation mutation decreasing interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false anm42_arath AtPRMT10 724503 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false methylation methylation reaction methylation false false false f2a f2b mint mbp-prmt10 724501 anm42_arath AtPRMT10 724503 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mbp_human MBP 724505 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified methylation methylation reaction methylation false false false f2a mint