IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gao-2007b-1 Identification and characterization of follistatin as a novel angiogenin-binding protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Gao X., Hu H., Zhu J., Xu Z. Cancer - Interactions investigated in the context of cancer Source of angiogenin from PMID 11549292 zpxu@zju.edu.cn A human heart cDNA library was used. FEBS Lett. (0014-5793) 2007 Only protein-protein interactions imex curation gao-2007b-2 Identification and characterization of follistatin as a novel angiogenin-binding protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gao X., Hu H., Zhu J., Xu Z. Cancer - Interactions investigated in the context of cancer Source of angiogenin from PMID 11549292 zpxu@zju.edu.cn A human heart cDNA library was used. FEBS Lett. (0014-5793) 2007 Only protein-protein interactions imex curation gao-2007b-3 Identification and characterization of follistatin as a novel angiogenin-binding protein. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Gao X., Hu H., Zhu J., Xu Z. Cancer - Interactions investigated in the context of cancer Source of angiogenin from PMID 11549292 zpxu@zju.edu.cn A human heart cDNA library was used. FEBS Lett. (0014-5793) 2007 Only protein-protein interactions imex curation gao-2007b-4 Identification and characterization of follistatin as a novel angiogenin-binding protein. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Gao X., Hu H., Zhu J., Xu Z. Cancer - Interactions investigated in the context of cancer Source of angiogenin from PMID 11549292 zpxu@zju.edu.cn A human heart cDNA library was used. FEBS Lett. (0014-5793) 2007 Only protein-protein interactions imex curation gao-2007b-5 Identification and characterization of follistatin as a novel angiogenin-binding protein. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Gao X., Hu H., Zhu J., Xu Z. Cancer - Interactions investigated in the context of cancer Source of angiogenin from PMID 11549292 zpxu@zju.edu.cn A human heart cDNA library was used. FEBS Lett. (0014-5793) 2007 Only protein-protein interactions imex curation p19883-2 Follistatin FST Activin-binding protein FS288 FS-288 protein protein human Homo sapiens Human MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN angi_human Angiogenin Ribonuclease 5 ANG RNASE5 protein protein human Homo sapiens Human MVMGLGVLLLVFVLGLGLTPPTLAQDNSRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLPVHLDQSIFRRP fst_human Follistatin Activin-binding protein FST protein protein human Homo sapiens Human MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW ang-fst Angiogenin interacts with follistatin in a yeast two-hybrid assay 693237 N/A 693242 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 693243 unspecified role unspecified role bait bait physical association physical association false false false PREY gene NM_006350 Fig. 4 A ang-fst-1 Angiogenin interacts with follistatin in a directed yeast two-hybrid assay 693238 N/A 693242 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false N/A 693243 unspecified role unspecified role bait bait physical association physical association false false false author score author-based confidence author score A score generated by an author, usually only relevant for that particular dataset. PREY gene NM_006350 Fig. 1 A, 4 PREY gene NM_006350 fst-ang His-follistatin pulls down angiogenin in vitro 693239 N/A 693243 unspecified role unspecified role prey prey N/A 693244 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecobb Escherichia coli (strain B / BL21) physical association physical association false false false 1 B ang-fst-2 YFP-angiogenin and CFP-follistatin colocalize in the nuclei of HeLa cells 693240 N/A 693243 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 693244 unspecified role unspecified role neutral component neutral component region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Fig. 2 C ang-fst-3 693241 N/A 693243 unspecified role unspecified role fluorescence donor fluorescence donor region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false N/A 693244 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig. 3