IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ perez_perez-2008-1 Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C). yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Perez-Perez JM., Serralbo O., Vanstraelen M., Gonzalez C., Criqui MC., Genschik P., Kondorosi E., Scheres B. The accession numbers for this entry were obtained from TIAR using the protein names provided or where this was not possible proteins were identified from the literature. b.scheres@uu.nl Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation perez_perez-2008-2 Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C). arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Perez-Perez JM., Serralbo O., Vanstraelen M., Gonzalez C., Criqui MC., Genschik P., Kondorosi E., Scheres B. Transgenic arabidopsis plants expressing hemaglutinin (HA)-tagged Hobbit (HBT) protein was used in this study. The accession numbers for this entry were obtained from TIAR using the protein names provided or where this was not possible proteins were identified from the literature. b.scheres@uu.nl Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation perez_perez-2008-3 Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C). arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Perez-Perez JM., Serralbo O., Vanstraelen M., Gonzalez C., Criqui MC., Genschik P., Kondorosi E., Scheres B. Transgenic arabidopsis plants expressing hemaglutinin (HA)-tagged Hobbit (HBT) protein was used in this study. The accession numbers for this entry were obtained from TIAR using the protein names provided or where this was not possible proteins were identified from the literature. b.scheres@uu.nl Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation perez_perez-2008-4 Specialization of CDC27 function in the Arabidopsis thaliana anaphase-promoting complex (APC/C). arath-root Arabidopsis thaliana root tissue root In vascular plants, the root is that organ of a plant body that typically lies below the surface of the soil (compare with stem). However, this is not always the case, since a root can also be aerial (that is, growing above the ground) or aerating (that is, growing up above the ground or especially above water). On the other hand, a stem normally occurring below ground is not exceptional either (see rhizome). So, it is better to define root as a part of a plant body that bears no leaves, and therefore also lacks nodes. There are also important internal structural differences between stems and roots. The two major functions of roots are 1) absorption of water and inorganic nutrients and 2) anchoring the plant body to the ground. Roots also function in cytokinin synthesis, which supplies some of shoot needs. They often function in storage of food. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Perez-Perez JM., Serralbo O., Vanstraelen M., Gonzalez C., Criqui MC., Genschik P., Kondorosi E., Scheres B. Transgenic arabidopsis plants expressing hemaglutinin (HA)-tagged Hobbit (HBT) protein was used in this study. The accession numbers for this entry were obtained from TIAR using the protein names provided or where this was not possible proteins were identified from the literature. b.scheres@uu.nl Plant J. (0960-7412) 2008 Only protein-protein interactions imex curation cd27b_arath Cell division cycle protein 27 homolog B CDC27B At2g20000 HBT Protein HOBBIT T2G17.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEAMLVDCVNNSLRHFVYKNAIFMCERLCAEFPSEVNLQLLATSYLQNNQAYSAYHLLKGTQMAQSRYLFALSCFQMDLLNEAESALCPVNEPGAEIPNGAAGHYLLGLIYKYTDRRKNAAQQFKQSLTIDPLLWAAYEELCILGAAEEATAVFGETAALSIQKQYMQQLSTSLGLNTYNEERNSTSTKNTSSEDYSPRQSKHTQSHGLKDISGNFHSHGVNGGVSNMSFYNTPSPVAAQLSGIAPPPLFRNFQPAVANPNSLITDSSPKSTVNSTLQAPRRKFVDEGKLRKISGRLFSDSGPRRSSRLSADSGANINSSVATVSGNVNNASKYLGGSKLSSLALRSVTLRKGHSWANENMDEGVRGEPFDDSRPNTASTTGSMASNDQEDETMSIGGIAMSSQTITIGVSEILNLLRTLGEGCRLSYMYRCQEALDTYMKLPHKHYNTGWVLSQVGKAYFELIDYLEAEKAFRLARLASPYCLEGMDIYSTVLYHLKEDMKLSYLAQELISTDRLAPQSWCAMGNCYSLQKDHETALKNFLRAVQLNPRFAYAHTLCGHEYTTLEDFENGMKSYQNALRVDTRHYNAWYGLGMIYLRQEKLEFSEHHFRMAFLINPSSSVIMSYLGTSLHALKRSEEALEIMEQAIVADRKNPLPMYQKANILVCLERLDEALEVLEELKEYAPSESSVYALMGRIYKRRNMHDKAMLHFGLALDMKPPATDVAAIKAAMEKLHVPDEIDESP cdc21_arath Cell division cycle 20.1, cofactor of APC complex CDC20-1 CDC20_2 F17M5.30 At4g33270 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDAGMNNTSSHYKTQARCPLQEHFLPRKPSKENLDRFIPNRSAMNFDYAHFALTEGRKGKDQTAAVSSPSKEAYRKQLAETMNLNHTRILAFRNKPQAPVELLPSNHSASLHQQPKSVKPRRYIPQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALDHTVYLWDASTGSTSELVTIDEEKGPVTSINWAPDGRHVAVGLNNSEVQLWDSASNRQLRTLKGGHQSRVGSLAWNNHILTTGGMDGLIINNDVRIRSPIVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQVCSLLWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVASAAGDETLRFWNVFGVPETAKKAAPKAVSEPFSHVNRIR cdc22_arath Cell division cycle 20.2, cofactor of APC complex CDC20-2 CDC20_1 F17M5.20 At4g33260 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDAGLNRCPLQEHFLPRKNSKENLDRFIPNRSAMNFDYAHFALTEERKGKDQSATVSSPSKEAYRKQLAETMNLNHTRILAFRNKPQAPVELLPSNHSASLHQQPKSVKPRRYIPQTSERTLDAPDIVDDFYLNLLDWGSANVLAIALDHTVYLWDASTGSTSELVTIDEEKGPVTSINWAPDGRHVAVGLNNSEVQLWDSASNRQLRTLKGGHQSRVGSLAWNNHILTTGGMDGLIINNDVRIRSPIVETYRGHTQEVCGLKWSGSGQQLASGGNDNVVHIWDRSVASSNSTTQWLHRLEEHTSAVKALAWCPFQANLLATGGGGGDRTIKFWNTHTGACLNSVDTGSQVCSLLWSKNERELLSSHGFTQNQLTLWKYPSMVKMAELTGHTSRVLYMAQSPDGCTVASAAGDETLRFWNVFGVPETAKKAAPKAVAEPFSHVNRIR cdc24_arath Cell division cycle 20.4, cofactor of APC complex At5g26900 CDC20-4 CDC20_3 F2P16.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDSGMRATCTVPEHFLPRKLSKQNLDRFIPNRSAKDFDFANYALTQGSKRNLDEVTSASRKAYMTQLAVVMNQNRTRILAFRNKPKSLLSTNHSDSPHQNPKPVKPRRYIPQNSERVLDAPGLRDDFSLNLLDWGSANVLAIALGDTVYLWDASSGSTSELVTIDEDKGPVTSINWTQDGLDLAVGLDNSEVQLWDCVSNRQVRTLRGGHESRVGSLAWDNHILTTGGMDGKIVNNDVRIRSSIVETYLGHTEEVCGLKWSESGNKQASGGNDNVVHIWDRSLASSKQTRQWLHRFEEHTAAVRALAWCPFQASLLATGGGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSQSERELLSSHGFTQNQLTLWKYPSMSKMAELNGHTSRVLFMAQSPNGCTVASAAGDENLRLWNVFGEPPKTTKKAASKKYPELFSHVNSLR cd205_arath Cell division cycle 20.5, cofactor of APC complex CDC20-5 CDC20_5 F15A18.30 At5g27570 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMNTSSHLKAQASCPLVEHFLRRKLSKENFDRFIPNRSAMDFDFANYALTQGRKRNVDEVTSASRKAYMTQLAEAMNQNRTRILAFRNKPKALLSSNHSDPPHQQPISVKPRRYIPQNSERVLDAPGIADDFYLNLLDWGSSNVLAIALGDTVYLWDASSGSTYKLVTIDEEEGPVTSINWTQDGLDLAIGLDNSEVQLWDCVSNRQVRTLRGGHESRVGSLAWNNHILTTGGMDGKIVNNDVRIRSSIVETYLGHTEEVCGLKWSESGKKLASGGNDNVVHIWDHRSVASSNPTRQWLHRFEEHTAAVRALAWCPFQASLLATGGGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSKSERELLSSHGFTQNQLTLWKYPSMVKMAELNGHTSRVLFMAQSPDGCTVASAAGDETLRLWNVFGEPPKTTKKAASKKYTDPFAHVNHIR fzr2_arath Protein FIZZY-RELATED 2 At4g22910 FZR2 CCS52A1 Cell cycle switch protein CCS52A1 F7H19.90 CDH1-2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEEDPTASNVITNSNSSSMRNLSPAMNTPVVSLESRINRLINANQSQSPSPSSLSRSIYSDRFIPSRSGSNFALFDLSPSPSKDGKEDGAGSYATLLRAAMFGPETPEKRDITGFSSSRNIFRFKTETHRSLNSFSPFGVDDDSPGVSHSGPVKAPRKVPRSPYKVLDAPALQDDFYLNLVDWSAQNVLAVGLGNCVYLWNACSSKVTKLCDLGAEDSVCSVGWALRGTHLAVGTSTGKVQIWDASRCKRTRTMEGHRLRVGALAWGSSVLSSGSRDKSILQRDIRCQEDHVSKLAGHKSEVCGLKWSYDNRELASGGNDNRLFVWNQHSTQPVLKYSEHTAAVKAIAWSPHVHGLLASGGGTADRCIRFWNTTTNTHLSSIDTCSQVCNLAWSKNVNELVSTHGYSQNQIIVWKYPTMSKIATLTGHTYRVLYLAVSPDGQTIVTGAGDETLRFWNVFPSPKSQNTDSEIGSSFFGRTTIR fzr1_arath Protein FIZZY-RELATED 1 At4g11920 FZR1 CCS52A2 Cell cycle switch protein CCS52A2 T26M18.130 CDH1-1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEDESTTPKKKSDSQLNLPPSMNRPTVSLESRINRLIDSNHYHSPSKPIYSDRFIPSRSGSNFALFDLASSSPNKKDGKEDGAGSYASLLKTALFGPVTPEKSDVVNGFSPSGNIFRFKTETQRSLNLYPPFDSDVVSGVSPSPVKSPRKILRSPYKVLDAPALQDDFYLNLVDWSAQNVLAVGLGNCVYLWNACSSKVTKLCDLGVDETVCSVGWALRGTHLAIGTSSGTVQIWDVLRCKNIRTMEGHRLRVGALAWSSSVLSSGSRDKSILQRDIRTQEDHVSKLKGHKSEICGLKWSSDNRELASGGNDNKLFVWNQHSTQPVLRFCEHAAAVKAIAWSPHHFGLLASGGGTADRCIRFWNTTTNTHLNCVDTNSQVCNLVWSKNVNELVSTHGYSQNQIIVWKYPTMSKLATLTGHSYRVLYLAVSPDGQTIVTGAGDETLRFWNVFPSPKSQSRESEIGALSFGRTTIR fzr3_arath Protein FIZZY-RELATED 3 At5g13840 FZR3 CCS52B Cell cycle switch protein CCS52B MAC12.21 CDH1-3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASPQSTKTGLNLPAGMNQTSLRLETFSSSFRGISSLSSPSKSTCSDRFIPCRSSSRLHAFDLQDKEPTTPVKEGGNEAYSRLLKSELFGSDFASPLLSPAGGQGSASSPMSPCTNMLRFKTDRSNSSPSSPFSPSILGNDNGHSSDSSPPPKPPRKVPKTPHKVLDAPSLQDDFYLNVVDWSSQNVLAVGLGTCVYLWTASNSKVTKLCDLGPNDSVCSVQWTREGSYISIGTSHGQVQVWDGTQCKRVRTMGGHQTRTGVLAWNSRILSSGSRDRNILQHDIRVQSDFVSKLVGHKSEVCGLKWSHDDRELASGGNDNQLLVWNNHSQQPILKLTEHTAAVKAITWSPHQSSLLASGGGTADRCIRFWNTTNGNQLNSIDTGSQVCNLAWSKNVNEIVSTHGYSQNQIMLWKYPSMSKVATLTGHSMRVLYLATSPDGQTIVTGAGDETLRFWNVFPSVKMQTPVKDTGLWSLGRTQIR apc10_arath Anaphase-promoting complex subunit 10 APC10 Cyclosome subunit 10 T30D6.20 At2g18290 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATESSESEEEGKISGGNYKLIIDDDLREMGKNAAWSVSSCKPGNGVTTLRDDNLETYWQSDGLQPHLINIQFQKKVKLQLVVLYVDFKLDESYTPSKISIRAGDGFHNLKEIKSVELVKPTGWVCLSLSGTDPRETFVNTFMLQIAILSNHLNGRDTHIRQIKVYGPRPNPIPHQPFQFTSMEFLTYSTLR cd27a_arath Cell division cycle protein 27 homolog A CDC27A APC3 Anaphase-promoting complex subunit 3 T02O04.19 At3g16320 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMENLLANCVQKNLNHFMFTNAIFLCELLLAQFPSEVNLQLLARCYLSNSQAYSAYYILKGSKTPQSRYLFAFSCFKLDLLGEAEAALLPCEDYAEEVPGGAAGHYLLGLIYRYSGRKNCSIQQFRMALSFDPLCWEAYGELCSLGAAEEASTVFGNVASQRLQKTCVEQRISFSEGATIDQITDSDKALKDTGLSQTEHIPGENQQDLKIMQQPGDIPPNTDRQLSTNGWDLNTPSPVLLQVMDALPPLLLKNMRRPAVEGSLMSVHGVRVRRRNFFSEELSAEAQEESGRRRSARIAARKKNPMSQSFGKDSHWLHLSPSESNYAPSLSSMIGKCRIQSSKEATTSGQSVSDIGSSVDDEEKSNPSESSPDRFSLISGISEVLSLLKILGDGHRHLHMYKCQEALLAYQKLSQKQYNTHWVLMQVGKAYFELQDYFNADSSFTLAHQKYPYALEGMDTYSTVLYHLKEEMRLGYLAQELISVDRLSPESWCAVGNCYSLRKDHDTALKMFQRAIQLNERFTYAHTLCGHEFAALEEFEDAERCYRKALGIDTRHYNAWYGLGMTYLRQEKFEFAQHQFQLALQINPRSSVIMCYYGIALHESKRNDEALMMMEKAVLTDAKNPLPKYYKAHILTSLGDYHKAQKVLEELKECAPQESSVHASLGKIYNQLKQYDKAVLHFGIALDLSPSPSDAVKIKAYMERLILPDELVTEENL apc2_arath Anaphase-promoting complex subunit 2 APC2 Cyclosome subunit 2 F28I8.30 At2g04660 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEALGSSDCNLEILETLSDDAIQEITESYDGFFTTVESLIAGTGDSLVEDEFVSHVYCLCKYGLDSLVRDHFLRSLEQAFEKGGASSFWQHFDAYSEKKHHNYGEEIQIVLCKALEEISIEKQYHEKCLSIVVHALQSFKEQSSDDRQNSDTERVHLFSRFQSMLSSTLMTTLPQHFPEILHWYFKERLEELSAIMDGDGIEEQEDDCMDLDEKLRYKNGEMDVDEGCSQGKRLGHDKLVKNIGKVVRDLRSIGFTSMAENAYASAIFLLLKAKVHDLAGDDYRTSVLESIKEWIQTVPLQFLNALLSYLGDSVSYGTTSSGLTSPLACCPSPSFSRVVTPSEGIVRWKLRLEYFAYETLQDLRIAKLFEIIVDYPESSPAIEDLKQCLEYTGQHSKLVESFISSLKYRLLTAGASTNDILHQYVSTIKALRAIDPAGVFLEAVGEPIRDYLRGRKDTIKCIVTMLTDGSGGNANGSGNPGDSLLEELMRDEESQENVGFDDDFHTDDKQAWINASRWEPDPVEADPLKGSLSQRKVDILGMLVDIIGSKEQLVNEYRVMLAEKLLNKTDYDIDTEIRTVELLKIHFGEASMQRCEIMLNDLIDSKRVNTNIKKASQTGAELRENELSVDTLTSTILSTNFWPPIQDEPLELPGPVDKLLSDYANRYHEIKTPRKLLWKKNLGTVKLELQFEDRAMQFTVSPTHAAIIMQFQEKKSWTYKDLAEVIGIPIDALNRRVNFWISKGVLRESTGANSNSSVLTLVESITDSGKNEGEELLTGEEEGETSIASVEDQLRKEMTIYEKFIMGMLTNFGSMALERIHNTLKMFCVADPSYDKSLQQLQSFLSGLVSEEKLEFRDGMYLLKK cdc20_1-hbt CDC20.1 interacts wth Hobbit protein (At2g20000) 729681 N/A 729685 unspecified role unspecified role prey prey N/A 729686 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a cdc20_2-hbt-1 CDC20.2 interacts wth Hobbit protein (At2g20000) 729681 n/a 729687 unspecified role unspecified role bait bait N/A 729685 unspecified role unspecified role prey prey physical association physical association false false false Figure 4a cdc20_4-hbt CDC20.4 interacts wth Hobbit protein (At2g20000) 729681 N/A 729685 unspecified role unspecified role prey prey N/A 729688 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a cdc20_5-hbt CDC20.5 interacts wth Hobbit protein (At2g20000) 729681 N/A 729685 unspecified role unspecified role prey prey N/A 729689 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a at4g22910-hbt-1 CCS52A1 (At4g22910) interacts wth Hobbit protein (At2g20000) 729681 N/A 729690 unspecified role unspecified role bait bait N/A 729685 unspecified role unspecified role prey prey physical association physical association false false false Figure 4a at4g11920-hbt-2 CCS52A2 (At4g11920) interacts wth Hobbit protein (At2g20000) 729681 N/A 729685 unspecified role unspecified role prey prey N/A 729691 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a at5g13840-hbt-3 CCS52B (At5g13840) interacts wth Hobbit protein (At2g20000) 729681 N/A 729685 unspecified role unspecified role prey prey N/A 729692 unspecified role unspecified role bait bait physical association physical association false false false Figure 4a apc10-hbt-1 APC10 interacts wth Hobbit protein (At2g20000) 729681 N/A 729685 unspecified role unspecified role prey prey N/A 729693 unspecified role unspecified role bait bait physical association physical association false false false Figure 4b The authors speculate that this interaction indicates HBT is part of the APC/C complex. apc10-hbt-2 Hobbit protein (At2g20000) intercats with APC10 729681 N/A 729693 unspecified role unspecified role prey prey N/A 729685 unspecified role unspecified role bait bait physical association physical association false false false Figure 4b The authors speculate that this interaction indicates HBT is part of the APC/C complex. apc10-cdc27a APC10 interacts wth the CDC27a protein 729681 N/A 729694 unspecified role unspecified role prey prey N/A 729693 unspecified role unspecified role bait bait physical association physical association false false false Figure 4b cdc27a-apc10 CDC27a protein interacts with APC10 729681 N/A 729693 unspecified role unspecified role prey prey N/A 729694 unspecified role unspecified role bait bait physical association physical association false false false Figure 4b hbt-hbt Hobbit protein (At2g20000) homodimer 729681 N/A 729685 unspecified role unspecified role bait bait N/A 729685 unspecified role unspecified role prey prey physical association physical association false false false Figure 4b hbt-at2g04660 Hobbit protein (At2g20000) interacts with APC2 ( AT2G04660) 729682 N/A 729695 unspecified role unspecified role prey prey N/A 729685 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 4c at2g04660-hbt APC2 ( AT2G04660) interacts with Hobbit protein (At2g20000) 729683 N/A 729695 unspecified role unspecified role bait bait N/A 729685 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 4c at2g04660-at3g16320 APC2 ( AT2G04660) interacts with CDC27a (AT3G16320.) 729684 N/A 729694 unspecified role unspecified role prey prey N/A 729695 unspecified role unspecified role bait bait physical association physical association false false false Figure 4c