MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint prudden-2007-1 SUMO-targeted ubiquitin ligases in genome stability. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation prudden-2007-2 SUMO-targeted ubiquitin ligases in genome stability. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation prudden-2007-5 SUMO-targeted ubiquitin ligases in genome stability. spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation prudden-2007-4 SUMO-targeted ubiquitin ligases in genome stability. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Prudden J., Pebernard S., Raffa G., Slavin DA., Perry JJ., Tainer JA., McGowan CH., Boddy MN. EMBO J. (0261-4189) 2007 2009-01-08 Only protein-protein interactions imex curation nse5_schpo Non-structural maintenance of chromosome element 5 SPBC651.10 nse5 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNSALKAIIELCIEEDLLPKSLDVLEYLLSTTSIPIPACYIRMCITLLVHPEYPTSSNIQESCNWILQQVVENRSKINFDAWSFENDLSDNDMPKENYLKIFSNQCLFTQDVDYWDLIAYMSSRPPDLERWMSLMDIWLRILEIDAEENGSALMKKYMGEDLCELQDAIRICFSCFTLPQQTMESPFATSMSKAPAKTESRGSNSFEGTSRLANLGAKLLCLIWAMLPKGRFFVVHLTDAFHFLSKLDERFSKLNAKQQDLFFGNLGASNLRYCLSQYILMKGIGIGINIRHTRCEFTKQLTQLLPTSLPKNKIRQKLHLRAWVSFLGSALRESDRNFDKELFYTTLKQLYTMYQQTELVGIDRPMAILKDMLVLLDISKKLSLDKIV rfp1_schpo E3 ubiquitin-protein ligase complex slx8-rfp subunit rfp1 RING-type E3 ubiquitin transferase rfp1 rfp1 mug140 Meiotically up-regulated gene 140 protein RING finger protein 1 SPAC19A8.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MQFNGSNGIDESSVIDLTRSPSPPVETSISSTNIIDLDAIPDDSFPSSPVLSPRRRRMNRRRNERSRNFPSNHLSYLEDMIYLGPQVSTRRSSSRRDLMGMIARTFPEFSSVNSLSPSLFQLIVNRMRFDAIHPEWTNGSDDEYFSNHFEESYDDFTSSLENIKQSYKPPGPPKSGFTRSFNNDTLMVCPRCQEPLGTSKSKEKSALWATKCGHVYCGSCAKVLKTSKRSQSKCLVNDCGRYLNTKNAMWELFY nse6_schpo Non-structural maintenance of chromosome element 6 nse6 SPAC11E3.08c Core protein 1 cor1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNASNNISKFPDLDNSSKLIDHILDSDDSEELDELPDISSLVPSARAQSRKQYLKNDSSNSSTYRWNIDLLSSTATIDDSVAKRRKLAVQNLLQYDSTQTFQTGDEIDELIGKSVGSNVLNVLRSNPIYDDDLRYEYCSNSKARVPDWNTLKAECLKDNDLEFNEGIIPTTFGDLLSAKLVPLDIALSICSLQFFRSLGDTTCSEWIANLEKIFYSYKSSSNNLNQIVRFIFETTADMIGIDLAKRQVPIQLERTSASENLKSNLKIKVINFLKCCGTLYRFSDDTVRFEMIQDACRILIDNQVGSFCKWQFSQFMELPISLNPDFLISNIHKVSESPRVWVTILSSLSRSCQKFRKKIAFTLFVGKQSKNDDSDFSSLCQRLDEISASCNNDYTTLLYQIRTFGYAVDEKHFKTNERLECLLEKLRKIDLTISGSTDHLLLSRCEVKDCIHRLFMVLYYLNTNSAPELERIIESDLPNNNKQKDRYFKDKTSNLSMKENKSFSAKKVKKGKKKNKRQAYKR pmt3_schpo Ubiquitin-like protein pmt3/smt3 pmt3 smt3 ubl2 SPBC365.06 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSESPSANISDADKSAITPTTGDTSQQDVKPSTEHINLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQLGGCTHLCL rfp2_schpo E3 ubiquitin-protein ligase complex slx8-rfp subunit rfp2 rfp2 RING finger protein 2 RING-type E3 ubiquitin transferase rfp2 SPAC343.18 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MNLHGLELPGRDQRLSPEVIDLTEDIEDDGADVSEVTLLDLTRIPEFQPRRRIRTSRNHLDANLSNVPTINSIPSPVTRPPVAVGGGIFYGARRTRNRSQTQRRTLLENGFRNSRKKAQDSSNSIAERVSPPPGFCYDVHPHNNIACAKCGNELVSDEKKSIFAAKCGHLFCSTCAKELRKKTVPCPVQHCRKRITKKFIFPLYL mint rad60_schpo DNA repair protein rad60 rad60 SPBC1921.02 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDNLDEDDLAFFSKPIKKPPLNYAKQLIASSSDSEEESELDTNKQALEHINAQKNITHNENKSAEPLSRQSTILDADEGNQDVSDTTPNACLNEGRHSPKSAISCVTQPVSPVYNTRAAANLRNNSINSEAALSTTSSLLDDDFARRLEEIDRQVQEFEKSSSDMDVQIHTHKREIEEDDDNTSADVPLLKHSKSDHSTLYHSKSEFSTNEPVISVVLQLAVIGQRIPNSNISLPRDWEAPLFFKVKSNQQFRRVRIAYSERKKVDNVVLVFQNQRLWDYGTPKGAGMLKVDTRLVVHAYCHSDFISLKRIKELEVEKLSSVTEDSTAQTCKLITLLLRSSKSEDLRLSIPVDFTVKDLIKRYCTEVKISFHERIRLEFEGEWLDPNDQVQSTELEDEDQVSVVLD 5FF406D9FC791983 slx8_schpo E3 ubiquitin-protein ligase complex slx8-rfp subunit slx8 SPBC3D6.11c slx8 RING-dependent E3 ubiquitin-protein ligase slx8 RING finger protein slx8 Synthetic lethal of unknown function protein 8 RING-type E3 ubiquitin transferase slx8 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MPPAHKRDTNVRNLSAPYNIPSQSARVAAGNAAINRRRSSPVENSPGNGFPVSEDATDYPSGTTSENESLPLNRAPRSLREVASELAQEETLPVETSDLNIDVESEVFDLEDINFQNDADDINQRFTYNNHPASVENSLTNVNSIHAQPTTISDMIDLTDETSYDPRKQKFEQGKNPSTTNAEIEKEEPSKKQVVPSSQRLADYKCVICLDSPENLSCTPCGHIFCNFCILSALGTTAATQKCPVCRRKVHPNKVICLEMMLGSQKKKS mint nf2ip_human NFATC2-interacting protein Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein NFATC2IP NIP45 45 kDa NF-AT-interacting protein protein protein human Homo sapiens Human MAEPVGKRGRWSGGSGAGRGGRGGWGGRGRRPRAQRSPSRGTLDVVSVDLVTDSDEEILEVATARGAADEVEVEPPEPPGPVASRDNSNSDSEGEDRRPAGPPREPVRRRRRLVLDPGEAPLVPVYSGKVKSSLRLIPDDLSLLKLYPPGDEEEAELADSSGLYHEGSPSPGSPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSRTHTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPLRMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQLRVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG rnf4_human E3 ubiquitin-protein ligase RNF4 SNURF RING finger protein 4 Small nuclear ring finger protein RNF4 RES4-26 RING-type E3 ubiquitin transferase RNF4 protein protein human Homo sapiens Human MSTRKRRGGAINSRQAQKRTREATSTPEISLEAEPIELVETAGDEIVDLTCESLEPVVVDLTHNDSVVIVDERRRPRRNARRLPQDHADSCVVSSDDEELSRDRDVYVTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI nse5-rfp1 720517 nse5_schpo 720521 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rfp1_schpo 720522 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1A mint nse5-nse6-4 720517 nse6_schpo 720523 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false nse5_schpo 720521 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint pmt3-rfp1 720517 pmt3_schpo 720524 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rfp1_schpo 720522 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rfp2_schpo 720525 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint rfp1-pmt3-3 720517 rfp1_schpo 720522 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false SIM pmt3_schpo 720524 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F3B mint rfp1-rad60-1 720517 rad60_schpo 720526 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rfp1_schpo 720522 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tagged molecule tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false SIM physical association physical association false false false F5A mint rfp1-slx8-1 720518 rfp1_schpo 720522 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false slx8_schpo 720527 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint slx8-rfp1 720518 rfp1_schpo 720522 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate his tagged his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false slx8_schpo 720527 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false SF1 domino mint rfp2-slx8-1 720518 slx8_schpo 720527 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rfp2_schpo 720525 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F1B mint rad60-slx8 720518 rad60_schpo 720526 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified gst tagged gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false slx8_schpo 720527 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F5B mint slx8-rfp1-1 720519 rfp1_schpo 720522 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false slx8_schpo Slx-8 720527 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false SF2B mint rfp2-slx8-2 720519 rfp2_schpo 720525 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false slx8_schpo 720527 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false SF2C mint rfp2-rfp1 720519 rfp1_schpo 720522 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell ha tagged ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rfp2_schpo 720525 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false SF2C The interaction is distroyed when slx8 is also overespressed. mint nfatc2ip-rnf4 720520 nf2ip_human 720528 anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell flag tagged flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false rnf4_human 720529 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell myc tagged myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F6D Overexpression of SUMO increases this interaction. homomint mint