IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ samson-2007-1 Def-6, a guanine nucleotide exchange factor for Rac1, interacts with the skeletal muscle integrin chain alpha7A and influences myoblast differentiation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Samson T., Will C., Knoblauch A., Sharek L., von der Mark K., Burridge K., Wixler V. thomas_samson@med.unc.edu A human placenta cDNA library was used. J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation samson-2007-2 Def-6, a guanine nucleotide exchange factor for Rac1, interacts with the skeletal muscle integrin chain alpha7A and influences myoblast differentiation. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Samson T., Will C., Knoblauch A., Sharek L., von der Mark K., Burridge K., Wixler V. thomas_samson@med.unc.edu A human placenta cDNA library was used. J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation samson-2007-3 Def-6, a guanine nucleotide exchange factor for Rac1, interacts with the skeletal muscle integrin chain alpha7A and influences myoblast differentiation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Samson T., Will C., Knoblauch A., Sharek L., von der Mark K., Burridge K., Wixler V. thomas_samson@med.unc.edu A human placenta cDNA library was used. J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation samson-2007-4 Def-6, a guanine nucleotide exchange factor for Rac1, interacts with the skeletal muscle integrin chain alpha7A and influences myoblast differentiation. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Samson T., Will C., Knoblauch A., Sharek L., von der Mark K., Burridge K., Wixler V. thomas_samson@med.unc.edu A human placenta cDNA library was used. J. Biol. Chem. (0021-9258) 2007 Only protein-protein interactions imex curation q61738-6 Integrin alpha-7 Itga7 protein protein mouse Mus musculus Mouse MARIPRCDFLRPPGIYYLITSLLAGLFLPPAIAFNLDVMGAIRKEGEPGSLFGFSVALHRQLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGANVQKESKENQWLGVSVRSQGAGGKIVTCAHRYESRQRVDQALETRDVIGRCFVLSQDLAIRDELDGGEWKFCEGRPQGHEQFGFCQQGTAATFSPDSHYLVFGAPGTYNWKGTARVELCAQGSPDLAHLDDGPYEAGGEKEQDPRLIPVPANSYLGLLFVTNIDSSDPDQLVYKTLDPADRLTGPAGDLTLNSYLGFSIDSGKGLMRSEELSFVAGAPRANHKGAVVILRKDSATRLIPEVVLSGERLTSGFGYSLAVTDLNNDGWADLIVGAPYFFERQEELGGAVYVYMNQGGHWADISPLRICGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLGVVVKPSQVLEGEAVGIKSFGYSLSGGLDVDGNHYPDLLVGSLADTAALFRARPVLHVSQEIFIDPRAIDLEQPNCADGRLVCVDIKICFSYVAVPSSYSPSVALDYMLDGDTDRRLRGQVPRVTFLSRGLDDLRHQSSGTVWLKHQHDRVCGDTVFQLQENVKDKLRAIVVTLSYGLRTPPLGRQAPGQELPTVAPILNAHQPSTQRTEIHFLKQGCGQDKICQSNLQLERYQFCSRISDTEFQALPMDLDGRTALFALSGQPFIGLELTVTNLPSDPSRPQADGDDAHEAQLLVTLPASLRYSGVRALDSVEKPLCLSNDSASHVECELGNPMKRGAQVTFYLILSTSGITIETTELEVKLLLATISEQELDPVSVRAHVFIELPLSISGVATPQQLFFSGEVKGESAMRSERELGRKVKYEVTVSNQGQSLNTLGSANLNIMWPHEIANGKWLLYPMRVELEGGQGPGKRGICSPRPNILQLDVDSRDRRRRELGQPEPQEPPEKVEPSTSWWPVSSAEKRNMTLDCPRTAKCVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYMAVKSLEVIVRANITVKSSIKNLLLRDASTVIPVMVYLDPMAVVVEGVPWWVILLGVLAGLLVLALLVLLLWKCGFFRRNSPSSSFPTNYHRAHLAVQPSAMEAGGPGTVGWDSSSGRSTPRPPCPSTTQ Ref.5 (L16544) sequence is in conflict in position: 1086:G->A. Ref.1 (AAA16598) sequence is in conflict in positions: 1159:TQ->T. defi6_human Differentially expressed in FDCP 6 homolog IRF4-binding protein DEF6 IBP protein protein human Homo sapiens Human MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVLSSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRDTLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGSEECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTANRTYEMSASDTRQRQEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHRELQQALEGQLREAEQARASMQAEMELKEEEAARQRQRIKELEEMQQRLQEALQLEVKARRDEESVRIAQTRLLEEEEEKLKQLMQLKEEQERYIERAQQEKEELQQEMAQQSRSLQQAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPVTSSSFSGFQPPLLAHRDSSLKRLTRWGSQGNRTPSPNSNEQQKSLNGGDEAPAPASTPQEDKLDPAPEN swp70_human Switch-associated protein 70 KIAA0640 SWAP70 HSPC321 protein protein human Homo sapiens Human MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWVIFNFLSEDKYPLIIVSEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLVKCFDKTFEISASDKKKKQEWIQAIHSTIHLLKLGSPPPHKEARQRRKELRKKQLAEQEELERQMKELQAANESKQQELEAVRKKLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAEKQELENQRVLKEQALQEAMEQLEQLELERKQALEQYEEVKKKLEMATNKTKSWKDKVAHHEGLIRLIEPGSKNPHLITNWGPAAFTEAELEEREKNWKEKKTTE defi6_mouse Differentially expressed in FDCP 6 Def6 Ibp Slat IRF4-binding protein SWAP-70-like adapter of T-cells protein protein mouse Mus musculus Mouse MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLNIPHDPVALEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAKKNYRADGIGSSPLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKLLGSLSLEMGLGELEELLAQDAQSAQTAVGLSVWQFLELFNSGRCLRGVGRDSLSMAIQEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSSLCYFGSEECKEKRGTIPLDAHCCVEVLPDREGKRCMFCVKTASRTYEMSASDTRQRQEWTAAIQTAIRLQAEGKTSLHKDLKQKRREQREQRERRRAAKEEELLRLQQLQEEKERKLQELELLQEAQRQAERLLQEEEERRRSQHKELQQALEGQLREAEQARASMQAEMELKKEEAARQRQRIAELEEMQERLQEALQLEVKARRDEEAVRLAQTRLLEEEEEKLKQLMHLKEEQERYIERAQQEKQELQQEMALQSRSLQHAQQQLEEVRQNRQRADEDVEAAQRKLRQASTNVKHWNVQMNRLMHPIEPGDKRPTTSSSFTGFQPPPLARRDSSLKRLTRWGSQGNRTLSVNSSEQKSLNGGDETPILALASQEEKLDPAPGN swp70_mouse Switch-associated protein 70 Swap70 Kiaa0640 protein protein mouse Mus musculus Mouse MRGLKDELLKAIWHAFTALDLDRSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYMPYLNKFILEKVQDNFDKIEFNRMCWTLCVKKNLTKSPLLITEDDAFKVWVIFNFLSEDKYPLIIVPEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDNKDGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHKRKNWTERWFVLKPNIISYYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLIKCFDKTFEISASDKKKKQEWIQAIYSTIHLLKLGSPPPHKEARQRRKELRRKLLAEQEELERQMKELQAANENKQQELESVRKKLEEAASRAADEEKKRLQTQVELQTRFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVRELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEAEKQELEQQRVMKEQALQEAMAQLEQLELERKQALEQYEGVKKKLEMATHMTKSWKDKVAHHEGLIRLIEPGSKNPHLITNWGPAAFTQAELEEREKSWKEKKTTE itga7-def6 Itga7 (Integrin alpha7A) interacts with DEF6 in a yeast two-hybrid assay 743583 n/a 743587 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 743588 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene gi:3378242 itga7-swap70 Itga7 (Integrin alpha7A) interacts with SWAP70 in a yeast two-hybrid assay 743583 n/a 743587 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 743589 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene gi:3378242 itga7-def6-1 Itga7 (Integrin alpha7A) interacts with DEF6 in a directed yeast two-hybrid assay 743584 n/a 743587 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 743590 unspecified role unspecified role prey prey Q8C2K1:p.Tyr210Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false BAIT gene gi:3378242; PREY gene gi:142375804 Table 1, Figs. 1A, 2B, 3A Def-6 bound to integrin alpha7A about one order of magnitude stronger compared with the interaction between Swap-70 and integrin alpha7A. itga7-swap70-1 Itga7 (Integrin alpha7A) interacts with SWAP70 in a directed yeast two-hybrid assay 743584 n/a 743587 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 743591 unspecified role unspecified role prey prey physical association physical association false false false BAIT gene gi:3378242; PREY gene gi:40789274 Table 1, Fig. 2B Def-6 bound to integrin alpha7A about one order of magnitude stronger compared with the interaction between Swap-70 and integrin alpha7A. itga7-def6-2 Itga7 (Integrin alpha7A) interacts with DEF6 in a coimmunoprecipitation 743585 n/a 743587 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 743590 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Q8C2K1:p.Tyr210Glu mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false BAIT gene gi:3378242; PREY gene gi:142375804 Figs. 1B, 3B itga7-swap70-2 Itga7 (Integrin alpha7A) interacts with SWAP70 in a coimmunoprecipitation 743585 n/a 743587 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 743591 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false BAIT gene gi:3378242; PREY gene gi:40789274 Fig. 1B itga7-def6-3 Colocalisation of Itga7 (Integrin alpha7A)and DEF6 743586 n/a 743587 unspecified role unspecified role bait bait n/a 743590 unspecified role unspecified role prey prey colocalization colocalization false false false BAIT gene gi:3378242; PREY gene gi:142375804 Figs. 5D, 5E