IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ wenkel-2006-2 CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. The region given in the text as the CCT domain of COL15 is incorrect. It has been corrected in these entries. coupland@mpiz-koeln.mpg.de Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 Only protein-protein interactions imex curation wenkel-2006-1 CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 Only protein-protein interactions imex curation wenkel-2006-3 CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip autoradiography autoradiography Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. The authors concluded " coimmunoprecipitation of At HAP2a and GAD:CO was barely detectable (Figure 1A), suggesting that At HAP2a did not interact with GAD:CO or did so to a much lesser extent than At HAP3a and At HAP5a". Therefore interaction between CO and Hap2a were not curated. Details of the assay were obtained from a reference provided in the text. coupland@mpiz-koeln.mpg.de Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 Only protein-protein interactions imex curation wenkel-2006-4 CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. arath-leaf Arabidopsis thaliana leaf leaf leaf confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 Only protein-protein interactions imex curation wenkel-2006-5 CONSTANS and the CCAAT box binding complex share a functionally important domain and interact to regulate flowering of Arabidopsis. arath-leaf Arabidopsis thaliana leaf leaf leaf fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Wenkel S., Turck F., Singer K., Gissot L., Le Gourrierec J., Samach A., Coupland G. coupland@mpiz-koeln.mpg.de Arabidopsis cDNA libraries constructed from shoot apex and total plant tissue. Plant Cell (1040-4651) 2006 Only protein-protein interactions imex curation nfyc1_arath Nuclear transcription factor Y subunit C-1 NFYC1 HAP5A Transcriptional activator HAP5A T8P19.100 At3g48590 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTNNQQPPPSAAGIPPPPPGTTISAAGGGASYHHLLQQQQQQLQLFWTYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDEAAVLGGGMVVAPTASGVPYYYPPMGQPAGPGGMMIGRPAMDPNGVYVQPPSQAWQSVWQTSTGTGDDVSYGSGGSSGQGNLDGQG cons_arath Zinc finger protein CONSTANS CO F14F8_220 At5g15840 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLKQESNDIGSGENNRARPCDTCRSNACTVYCHADSAYLCMSCDAQVHSANRVASRHKRVRVCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRVPILPISGNSFSSMTTTHHQSEKTMTDPEKRLVVDQEEGEEGDKDAKEVASWLFPNSDKNNNNQNNGLLFSDEYLNLVDYNSSMDYKFTGEYSQHQQNCSVPQTSYGGDRVVPLKLEESRGHQCHNQQNFQFNIKYGSSGTHYNDNGSINHNAYISSMETGVVPESTACVTTASHPRTPKGTVEQQPDPASQMITVTQLSPMDREARVLRYREKRKTRKFEKTIRYASRKAYAEIRPRVNGRFAKREIEAEEQGFNTMLMYNTGYGIVPSF col15_arath Zinc finger protein CONSTANS-LIKE 15 COL15 F13K9.15 At1g28050 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSSSERVPCDFCGERTAVLFCRADTAKLCLPCDQQVHTANLLSRKHVRSQICDNCGNEPVSVRCFTDNLILCQECDWDVHGSCSVSDAHVRSAVEGFSGCPSALELAALWGLDLEQGRKDEENQVPMMAMMMDNFGMQLDSWVLGSNELIVPSDTTFKKRGSCGSSCGRYKQVLCKQLEELLKSGVVGGDGDDGDRDRDCDREGACDGDGDGEAGEGLMVPEMSERLKWSRDVEEINGGGGGGVNQQWNATTTNPSGGQSSQIWDFNLGQSRGPEDTSRVEAAYVGKGAASSFTINNFVDHMNETCSTNVKGVKEIKKDDYKRSTSGQVQPTKSESNNRPITFGSEKGSNSSSDLHFTEHIAGTSCKTTRLVATKADLERLAQNRGDAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVRGRFVKASEAPYP nfyc4_arath Nuclear transcription factor Y subunit C-4 NFYC4 MLE2.10 At5g63470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDNNNNNNNQQPPPTSVYPPGSAVTTVIPPPPSGSASIVTGGGATYHHLLQQQQQQLQMFWTYQRQEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREEIKEEEDAASALGGGGMVAPAASGVPYYYPPMGQPAVPGGMMIGRPAMDPSGVYAQPPSQAWQSVWQNSAGGGDDVSYGSGGSSGHGNLDSQG nfyc9_arath Nuclear transcription factor Y subunit C-9 NFYC9 HAP5C Transcriptional activator HAP5C F7G19.16 At1g08970 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQQDHGQSGAMNYGTNPYQTNPMSTTAATVAGGAAQPGQLAFHQIHQQQQQQQLAQQLQAFWENQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVLGSIPRGTVPEAAAAGYPYGYLPAGTAPIGNPGMVMGNPGGAYPPNPYMGQPMWQQQAPDQPDQEN nfyc3_arath Nuclear transcription factor Y subunit C-3 NFYC3 F14C21.41 T22H22.22 At1g54830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDQQGQSSAMNYGSNPYQTNAMTTTPTGSDHPAYHQIHQQQQQQLTQQLQSFWETQFKEIEKTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVVFARACEMFILELTLRSWNHTEENKRRTLQKNDIAAAVTRTDIFDFLVDIVPREDLRDEVLGGVGAEAATAAGYPYGYLPPGTAPIGNPGMVMGNPGAYPPNPYMGQPMWQQPGPEQQDPDN nfyc2_arath Nuclear transcription factor Y subunit C-2 NFYC2 HAP5B Transcriptional activator HAP5B F14G9.21 T6H22.3 At1g56170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQSEEGQQQQQQGVMDYVPPHAYQSGPVNAASHMAFQQAHHFHHHHQQQQQQQLQMFWANQMQEIEHTTDFKNHTLPLARIKKIMKADEDVRMISAEAPVIFAKACEMFILELTLRAWIHTEENKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELKEEGLGVTKGTIPSVVGSPPYYYLQQQGMMQHWPQEQHPDES nfyc5_arath Nuclear transcription factor Y subunit C-5 NFYC5 MBA10.4 At5g50490 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MENNNNNHQQPPKDNEQLKSFWSKGMEGDLNVKNHEFPISRIKRIMKFDPDVSMIAAEAPNLLSKACEMFVMDLTMRSWLHAQESNRLTIRKSDVDAVVSQTVIFDFLRDDVPKDEGEPVVAAADPVDDVADHVAVPDLNNEELPPGTVIGTPVCYGLGIHAPHPQMPGAWTEEDATGANGGNGGN nfyc7_arath Nuclear transcription factor Y subunit C-7 NFYC7 MBA10.2 At5g50470 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEENNGNNNHYLPQPSSSQLPPPPLYYQSMPLPSYSLPLPYSPQMRNYWIAQMGNATDVKHHAFPLTRIKKIMKSNPEVNMVTAEAPVLISKACEMLILDLTMRSWLHTVEGGRQTLKRSDTLTRSDISAATTRSFKFTFLGDVVPRDPSVVTDDPVLHPDGEVLPPGTVIGYPVFDCNGVYASPPQMQEWPAVPGDGEEAAGEIGGSSGGN nfyc6_arath Nuclear transcription factor Y subunit C-6 NFYC6 MBA10.3 At5g50480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAENNNNNGDNMNNDNHQQPPSYSQLPPMASSNPQLRNYWIEQMETVSDFKNRQLPLARIKKIMKADPDVHMVSAEAPIIFAKACEMFIVDLTMRSWLKAEENKRHTLQKSDISNAVASSFTYDFLLDVVPKDESIATADPGFVAMPHPDGGGVPQYYYPPGVVMGTPMVGSGMYAPSQAWPAAAGDGEDDAEDNGGNGGGN nfyb5_arath Nuclear transcription factor Y subunit B-5 NFYB5 F17A22.20 At2g47810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAGNYHSFQNPIPRYQNYNFGSSSSNHQHEHDGLVVVVEDQQQEESMMVKEQDRLLPIANVGRIMKNILPANAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWAMANLGFDDYAAQLKKYLHRYRVLEGEKPNHHGKGGPKSSPDN nfyb9_arath Nuclear transcription factor Y subunit B-9 NFYB9 LEC1 Protein LEAFY COTYLEDON 1 T26F17.20 At1g21970 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERGAPFSHYQLPKSISELNLDQHSNNPTPMTSSVVVAGAGDKNNGIVVQQQPPCVAREQDQYMPIANVIRIMRKTLPSHAKISDDAKETIQECVSEYISFVTGEANERCQREQRKTITAEDILWAMSKLGFDNYVDPLTVFINRYREIETDRGSALRGEPPSLRQTYGGNGIGFHGPSHGLPPPGPYGYGMLDQSMVMGGGRYYQNGSSGQDESSVGGGSSSSINGMPAFDHYGQYK nfyb6_arath Nuclear transcription factor Y subunit B-6 NFYB6 L1L MNJ7.26 At5g47670 Protein LEAFY COTYLEDON 1-LIKE protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERGGFHGYRKLSVNNTTPSPPGLAANFLMAEGSMRPPEFNQPNKTSNGGEEECTVREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGERGVSCSAGSVSMTNGLVVKRPNGTMTEYGAYGPVPGIHMAQYHYRHQNGFVFSGNEPNSKMSGSSSGASGARVEVFPTQQHKY nfyba_arath Nuclear transcription factor Y subunit B-10 NFYB10 F4P12_40 At3g53340 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAESQTGGGGGGSHESGGDQSPRSLNVREQDRFLPIANISRIMKRGLPLNGKIAKDAKETMQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKVYLMRYREMEGDTKGSGKGGESSAKRDGQPSQVSQFSQVPQQGSFSQGPYGNSQGSNMMVQMPGTE nfyb1_arath Nuclear transcription factor Y subunit B-1 NFYB1 HAP3A Transcriptional activator HAP3A T7F6.5 At2g38880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MADTPSSPAGDGGESGGSVREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARYRELEGDNKGSGKSGDGSNRDAGGGVSGEEMPSW co-hap5a 781048 n/a 781053 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-hap5a-1 781048 n/a 781053 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-lec1 781048 n/a 781056 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-hap5c 781048 n/a 781057 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-hap5c 781048 n/a 781057 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-at1g54830 781048 n/a 781058 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-hap5b 781048 n/a 781059 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-hap5b 781048 n/a 781059 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-hap3b 781048 n/a 781060 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-hap3b 781048 n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781060 unspecified role unspecified role prey prey physical association physical association false false false Table 1 co-at5g50470 781048 n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781061 unspecified role unspecified role prey prey physical association physical association false false false Table 1 col15-at5g50470 781048 n/a 781061 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-at5g50480 781048 n/a 781062 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-at5g50480 781048 n/a 781062 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-nfyb5 781048 n/a 781063 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-nfyb5 781048 n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781063 unspecified role unspecified role prey prey physical association physical association false false false Table 1 co-lec1 781048 n/a 781064 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-nfyb6 781048 n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781065 unspecified role unspecified role prey prey physical association physical association false false false Table 1 col15-nfyb10 781048 n/a 781066 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-nfyb1 781048 n/a 781067 unspecified role unspecified role prey prey n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 co-nfyb1-1 781048 n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781067 unspecified role unspecified role prey prey physical association physical association false false false Table 1 co-nfyc5 781048 n/a 781060 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1 col15-nfyb5-1 781048 n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781060 unspecified role unspecified role prey prey physical association physical association false false false Table 1 col15-nfyc4 781048 n/a 781055 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781056 unspecified role unspecified role prey prey physical association physical association false false false Table 1 co-nfyc1 781049 n/a 781053 unspecified role unspecified role prey prey n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false co-nfyc3 781049 n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781058 unspecified role unspecified role prey prey physical association physical association false false false co-nfyc2 781049 n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781059 unspecified role unspecified role prey prey physical association physical association false false false co-nfyb1 781049 n/a 781054 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 781067 unspecified role unspecified role prey prey physical association physical association false false false co-hap3a-1 781050 n/a 781054 unspecified role unspecified role bait bait region GAD tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 781067 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 1 co-hap5a-2 781050 n/a 781054 unspecified role unspecified role bait bait region GAD tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 781053 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 1 co-hap3a-2 781050 n/a 781053 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 781067 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 781054 unspecified role unspecified role bait bait region GAD tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false Figure 1 co-hap5a-1 781051 n/a 781054 unspecified role unspecified role neutral component neutral component n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 781053 unspecified role unspecified role neutral component neutral component n terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 3A co-hap3a-3 781051 n/a 781054 unspecified role unspecified role neutral component neutral component n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 781067 unspecified role unspecified role neutral component neutral component n terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false Figure 3A co-hap3a-4 781052 n/a 781054 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 781067 unspecified role unspecified role fluorescence donor fluorescence donor region cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 3B, 3C co-hap5a-3 781052 n/a 781054 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept n terminal yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 781053 unspecified role unspecified role fluorescence donor fluorescence donor n terminal cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Figure 3B, 3C