UniProt UniProt http://www.uniprot.org green-2003-6 A synthetic analysis of the Saccharomyces cerevisiae stress sensor Mid2p, and identification of a Mid2p-interacting protein, Zeo1p, that modulates the PKC1-MPK1 cell integrity pathway. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Green R., Lesage G., Sdicu AM., Menard P., Bussey H. howard.bussey@mcgill.ca Not specified. Microbiology 149 (2487-2499) 2003 Only protein-protein interactions imex curation green-2003-5 A synthetic analysis of the Saccharomyces cerevisiae stress sensor Mid2p, and identification of a Mid2p-interacting protein, Zeo1p, that modulates the PKC1-MPK1 cell integrity pathway. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Green R., Lesage G., Sdicu AM., Menard P., Bussey H. howard.bussey@mcgill.ca Not specified. Microbiology 149 (2487-2499) 2003 Only protein-protein interactions imex curation zeo1_yeast Protein ZEO1 Zeocin resistance protein 1 ZEO1 YOL109W O0738 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEIQNKAETAAQDVQQKLEETKESLQNKGQEVKEQAEASIDNLKNEATPEAEQVKKEEQNIADGVEQKKTEAANKVEETKKQASAAVSEKKETKKEGGFLKKLNRKIASIFN 1EA3634565D517FA mid2_yeast Cell wall integrity sensor MID2 SMS1 L8543.19 YLR332W MID2 KAI1 Mating pheromone-induced death protein 2 Serine-rich multicopy suppressor protein 1 Protein kinase A interference protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSFTTKNSFRLLLLILSCISTIRAQFFVQSSSSNSSAVSTARSSVSRVSSSSSILSSSMVSSSSADSSSLTSSTSSRSLVSHTSSSTSIASISFTSFSFSSDSSTSSSSSASSDSSSSSSFSISSTSATSESSTSSTQTSTSSSSSLSSTPSSSSSPSTITSAPSTSSTPSTTAYNQGSTITSIINGKTILSNHYTTVTYTPSATADSSNKSKSSGLSKKNRNIVIGCVVGIGVPLILVILALIYMFCIQSSRTDFIDSDGKVVTAYRANKFTKWWYMLLGKKVSDEYHSDSPLGGSASSAGGLDLDEADDVMEQSSLFDVRIRDSDSVLPNANTADHNNTNSGGEPINSSVASNDIIEEKFYDEQGNELSPRNY mid2-zeo1-1 741168 N/A 741170 unspecified role unspecified role prey prey N/A 741171 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Fig. 2B mid2-zeo1-2 741168 N/A 741171 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 741170 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2B The interaction is very weak. mid2-zeo1 741169 N/A 741171 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false N/A 741170 unspecified role unspecified role prey prey physical association physical association false false false Fig. 2A