IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ pawlowski-2003-2 Yeast two-hybrid studies on interaction of proteins involved in regulation of nitrogen fixation in the phototrophic bacterium Rhodobacter capsulatus. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pawlowski A., Riedel KU., Klipp W., Dreiskemper P., Gross S., Bierhoff H., Drepper T., Masepohl B. bernd.masepohl@ruhr-uni-bochum.de R. capsulatus genomic library J. Bacteriol. (0021-9193) 2003 Only protein-protein interactions imex curation pawlowski-2003-1 Yeast two-hybrid studies on interaction of proteins involved in regulation of nitrogen fixation in the phototrophic bacterium Rhodobacter capsulatus. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pawlowski A., Riedel KU., Klipp W., Dreiskemper P., Gross S., Bierhoff H., Drepper T., Masepohl B. bernd.masepohl@ruhr-uni-bochum.de J. Bacteriol. (0021-9193) 2003 Only protein-protein interactions imex curation ntrb_rhocb Sensory histidine kinase/phosphatase NtrB RCAP_rcc01797 ntrB nifR2 Nitrogen regulation protein NR(II) Nitrogen regulator II protein protein rhocb Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) MNLPPPGIIWNSLPLPALMLDVNDRVIEINPAAELFLNLSARALKGQALGERLAISAPLEEIFARVRKNRSALFVNDVDLTTGERAPVQCNLQAAPIADDPETVLLLISPREIADRLGRASMVKSAARSAIGMAEMLAHEIKNPLAGIAGAAQLLSMGLSGEDLELTDLIVDETRRIVKLLEQVEQFGNVRPPEMKPVNIHDVLDRARKSAGVGFGAHMLIVEDYDPSLPPTLGDADQLTQVFLNLLKNASEAAKGQGTIRLRTFYDYALRLRRPDGGGQRLPLQVEVIDDGPGIPADIASSIFEPFVSGRENGTGLGLALVSKIISEHNGWISVESAPGRTLFRISLPVAPKEL glnb_rhoca Nitrogen regulatory protein P-II glnB protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata MKKVEAIIKPFKLDEVKEALQEAGIQGLSVIEVKGFGRQKGHTELYRGAEYVVDFLPKVKIEMVLPDEMVDIAIEAIVGAARTEKIGDGKIFVSSIEQAIRIRTGETGEDAV q2mhs1_rhoca nifA2 protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata MRFTRSRRPLRRCPDP q52690_rhoca draT protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata MDQTFSPSARLGHSTNLVGAPSAWMASPGFNDRPVALHIWGVREMNPALFTMLDQAETLAEAGEPFWPIWCDVRHRPRAARRRPGQRKRFRSSFLRLIQGWGFDSNGPEGAVLKGWVESRFGILPSFHKEIIPDTQGPVWQAYVAERMQSRFHDNAILVQLDLLFEFCQWAVAVSPIRGKASDALSRHQCGRPAWHSGTAKPPRVIRLNNLVSFSSDREVADCFGDRIITTRVPLAKVLFFPGLLPSPLLRGEREFLVLGGAFRVSIEDI pcra_rhoca_protein protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata An amino acid sequence which is not represented in UniProt Similar to Q0S536 era_rhoca_protein protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata An amino acid sequence which is not represented in UniProt Similar to Q3J5W0 glnk_rhoca_protein protein protein rhoca Rhodobacter capsulatus Rhodopseudomonas capsulata An amino acid sequence which is not represented in UniProt glnb-ntrb-3 770191 n/a 770193 unspecified role unspecified role prey prey n/a 770194 unspecified role unspecified role bait bait physical association physical association false false false 2 glnb-nifa2 770191 n/a 770194 unspecified role unspecified role bait bait n/a 770195 unspecified role unspecified role prey prey physical association physical association false false false 2 glnb-drat 770191 n/a 770194 unspecified role unspecified role bait bait n/a 770196 unspecified role unspecified role prey prey physical association physical association false false false 2 glnb-pcra 770191 n/a 770197 unspecified role unspecified role prey prey n/a 770194 unspecified role unspecified role bait bait physical association physical association false false false 2 glnk-era 770191 n/a 770198 unspecified role unspecified role bait bait n/a 770199 unspecified role unspecified role prey prey physical association physical association false false false 2 glnb-ntrb 770192 n/a 770193 unspecified role unspecified role prey prey n/a 770194 unspecified role unspecified role bait bait physical association physical association false false false 1