UniProt UniProt http://www.uniprot.org loiseau-2003-1 Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. barras@ibsm.cnrs-mrs.fr J. Biol. Chem. 278 (38352-38359) 2003 Only protein-protein interactions imex curation mfontecabve@cea.fr loiseau-2003-3 Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. The activity was assayed from the amount of alanine formed from cysteine or selenocysteine. Selenocysteine solution was obtained after reduction of a 60 mM selenocystine-HCl solution with 10 mM dithiothreitol. barras@ibsm.cnrs-mrs.fr J. Biol. Chem. 278 (38352-38359) 2003 Only protein-protein interactions imex curation mfontecabve@cea.fr loiseau-2003-2 Biogenesis of Fe-S cluster by the bacterial Suf system: SufS and SufE form a new type of cysteine desulfurase. in vitro In vitro pull down pull down fingerprinting peptide massfingerprinting fingerprinting Loiseau L., Ollagnier-de-Choudens S., Nachin L., Fontecave M., Barras F. barras@ibsm.cnrs-mrs.fr J. Biol. Chem. 278 (38352-38359) 2003 Only protein-protein interactions imex curation mfontecabve@cea.fr sufe_dicd3 Cysteine desulfuration protein SufE Dda3937_03664 sufE protein protein dicd3 Dickeya dadantii (strain 3937) Erwinia chrysanthemi (strain 3937) MAQLPDPQKLLRNFSRCSNWEEKYLYIIELGAGLAPLSDAQRQDGNRVSGCQSQVWIDLASNEQGNVVLHGDSDAAIVKGLIAIVFSLYQGLSVREIVELDVRPFFASLALTQHLTPSRSQGLEAMLRAVRARASALI sufs_dicd3 Cysteine desulfurase sufS Selenocysteine lyase Selenocysteine reductase Selenocysteine beta-lyase Dda3937_03665 protein protein dicd3 Dickeya dadantii (strain 3937) Erwinia chrysanthemi (strain 3937) MNYPVEHYPIDRVRADFPILQQSVNGQPLAYLDSAASAQKPLAVIDRERDFYLHEYAAVHRGIHTLSARATSAMEEVRAKVATFIHAASAEDIVFVRGTTEAINLVANSYGRTAFQPGDNLVISEMEHHANIVPWQMLAQARGLTLRVLPITDDGELDMAQLPALLDERTRLVAVTQVSNVLGTVNPLAEIIRQAHACGAKVLVDGAQAVMHQAVDVQALDCDFYAFSGHKLYGPSGIGVLYGKSELLQAMPPWEGGGAMIREVSLTQGTTYADPPWRFEAGSPHVAGIIGLGAALDYVSALGVDAIQAHEGLLMRYALASLAEVPTLRLYGPVHRQGVIAFNLGRHHAFDVGSFLDQYGIAIRTGHHCAMPLMSRYGVPSMCRASLALYSCQDEIDRLVAGLHRIHRLLGE cysteine small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sufs-sufe 781456 n/a 781459 unspecified role unspecified role bait bait n/a 781460 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3 sufs-sufe-1 781456 n/a 781460 unspecified role unspecified role bait bait n/a 781459 unspecified role unspecified role prey prey physical association physical association false false false Fig. 3 sufs-sufs 781456 n/a 781460 unspecified role unspecified role prey prey n/a 781460 unspecified role unspecified role bait bait physical association physical association false false false Fig. 3 sufs-cys-sufe 781457 n/a 781460 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 781459 stimulator stimulator unspecified role unspecified role region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 781461 enzyme target enzyme target substrate substrate unspecified role unspecified role enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Fig. 5, 6, 7 and Table III. Km and Vmax for cystein are respectively 0.5 mM and 0.9 units/mg. Km and Vmax for selenocystein are respectively 2 mM and 5 units/mg. Temp = 37C sufc-cys-1 781457 n/a 781460 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 781461 enzyme target enzyme target substrate substrate unspecified role unspecified role enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction false false false Fig. 5, 6, 7 and Table III. Km and Vmax for cysteine are respectively 0.5 mM and 0.019 units/mg. Km and Vmax for selenocysteine are respectively 2 mM and 5 units/mg. Temp = 37C sufs-sufe-2 781458 n/a 781459 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 781460 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 4