IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bochkareva-2002a-1 Identification and characterization of the Escherichia coli stress protein UP12, a putative in vivo substrate of GroEL. ecoli Escherichia coli (strain K12) density sedimentation cosedimentation through density gradient density sedimentation protein sequence protein sequence identification protein sequence Bochkareva ES., Girshovich AS., Bibi E. 10-25% sucrose gradient prepared and after preparative centrifugation Analytical ultracentrifugations were carried out using 1.4 mL of a linear 5-20% sucrose gradient. To identify the proteins in the complex the proteins were dissociated from the GroEL complex by ATP, proteins were separated by SDS/PAGE, electroblotted onto poly(vinylidene difluoride) membranes, and subjected to N-terminal sequencing. elena.bochkareva@weizmann.ac.il Eur. J. Biochem. (0014-2956) 2002 Only protein-protein interactions imex curation bochkareva-2002a-2 Identification and characterization of the Escherichia coli stress protein UP12, a putative in vivo substrate of GroEL. ecoli Escherichia coli (strain K12) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Bochkareva ES., Girshovich AS., Bibi E. 10-25% sucrose gradient prepared and after preparative centrifugation Analytical ultracentrifugations were carried out using 1.4 mL of a linear 5-20% sucrose gradient. To identify the proteins in the complex the proteins were dissociated from the GroEL complex by ATP, proteins were separated by SDS/PAGE, electroblotted onto poly(vinylidene difluoride) membranes, and subjected to N-terminal sequencing. elena.bochkareva@weizmann.ac.il Eur. J. Biochem. (0014-2956) 2002 Only protein-protein interactions imex curation gaty_ecoli D-tagatose-1,6-bisphosphate aldolase subunit GatY gatY b2096 JW5343 D-tagatose-bisphosphate aldolase class II Tagatose-bisphosphate aldolase yegF protein protein ecoli Escherichia coli (strain K12) MYVVSTKQMLNNAQRGGYAVPAFNIHNLETMQVVVETAANLHAPVIIAGTPGTFTHAGTENLLALVSAMAKQYHHPLAIHLDHHTKFDDIAQKVRSGVRSVMIDASHLPFAQNISRVKEVVDFCHRFDVSVEAELGQLGGQEDDVQVNEADALYTNPAQAREFAEATGIDSLAVAIGTAHGMYASAPALDFSRLENIRQWVNLPLVLHGASGLSTKDIQQTIKLGICKINVATELKNAFSQALKNYLTEHPEATDPRDYLQSAKSAMRDVVSKVIADCGCEGRA D414AA3921BBFE2B ch60_ecoli Chaperonin GroEL groEL 60 kDa chaperonin Chaperonin-60 GroEL protein groL mopA JW4103 b4143 protein protein ecoli Escherichia coli (strain K12) MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFGAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGLKAVAAGMNPMDLKRGIDKAVTAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIAEAMDKVGKEGVITVEDGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILLADKKISNIREMLPVLEAVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEEAAIQGRVAQIRQQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDALHATRAAVEEGVVAGGGVALIRVASKLADLRGQNEDQNVGIKVALRAMEAPLRQIVLNCGEEPSVVANTVKGGDGNYGYNAATEEYGNMIDMGILDPTKVTRSALQYAASVAGLMITTECMVTDLPKNDAADLGAAGGMGGMGGMGGMM CD3A0FB505F74AD1 uspg_ecoli Universal stress protein UP12 ybdQ yzzU Universal stress protein G uspG b0607 JW0600 protein protein ecoli Escherichia coli (strain K12) MYKTIIMPVDVFEMELSDKAVRHAEFLAQDDGVIHLLHVLPGSASLSLHRFAADVRRFEEHLQHEAQERLQTMVSHFTIDPSRIKQHVRFGSVRDEVNELAEELGADVVVIGSRNPSISTHLLGSNASSVIRHANLPVLVVR grol-uspg 770114 n/a 770116 unspecified role unspecified role neutral component neutral component n/a 770117 unspecified role unspecified role neutral component neutral component n/a 770118 unspecified role unspecified role neutral component neutral component physical association physical association false false false 1 and 2 grol-uspg-1 770115 n/a 770117 unspecified role unspecified role bait bait n/a 770118 unspecified role unspecified role prey prey physical association physical association false false false 3