IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ tsutsui-2001-1 Multiple interactions among the components of the recombinational DNA repair system in Schizosaccharomyces pombe. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tsutsui Y., Khasanov FK., Shinagawa H., Iwasaki H., Bashkirov VI. Figure 1A, Table 1, Table 2, Table 3, Figure 4. vibashikirov@mail.ru Genetics (0016-6731) 2001 Only protein-protein interactions imex curation tsutsui-2001-2 Multiple interactions among the components of the recombinational DNA repair system in Schizosaccharomyces pombe. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Tsutsui Y., Khasanov FK., Shinagawa H., Iwasaki H., Bashkirov VI. Figure 1A, Table 1, Table 2, Table 3, Figure 4. vibashikirov@mail.ru Genetics (0016-6731) 2001 Only protein-protein interactions imex curation tsutsui-2001-3 Multiple interactions among the components of the recombinational DNA repair system in Schizosaccharomyces pombe. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Tsutsui Y., Khasanov FK., Shinagawa H., Iwasaki H., Bashkirov VI. Figure 1A, Table 1, Table 2, Table 3, Figure 4. vibashikirov@mail.ru Genetics (0016-6731) 2001 Only protein-protein interactions imex curation rad55_schpo DNA repair protein rhp55 rhp55 RAD55 homolog SPAC3C7.03c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLSSQHRLVTQPAIRAYEAFSAPGFGFNSKLLDDAFGGSGLKRGYISEVCGAPGMGKTSLALQITANALLSGSRVIWVETCQPIPMERLRQLLDNHVPSSQDEEEKCDTDELLNLLDVVYAPNLVNILAFLRNFDQEKHLKEIGLLIIDNLSMPIQLAYPTSPEDYAYLRLRRNTSKKSSLSDSSQKENTLTLNKENEFSSKDDSNFAFHNSSTKTTINRRKKAIGTISSLLSKITSSCYVAIFVTTQMTSKVVSGIGAKLIPLLSTNWLDNLSYRLILYSRHSTEESKDGQSRPSHQLLRYAFMAKQPPAHSAESELAFQLTSTGIQDYQSIPTNSSQRRKRSILECES rad57_schpo DNA repair protein rhp57 rhp57 RAD57 homolog SPAC20H4.07 SPAC145.01 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MDISNYVDNFYFDEKIASAFELGEVSTVDLLTLDITELERRTHCSQSELLQLIEQISLLLQPVRCSASKVTSKYLTTGDVKLDETLHGGIPVGQLTEICGESGSGKSQFCMQLCLMVQLPLSLGGMNKAAVFISTESGLETKRLFELARYLPERYPKADKKDIIIKNPGDRVYTILCPDLESQEHIIQYQLPILFNRDKIGLVILDSVASNYRAELRYNRSKSHFRDLDNIAKRGNQLGKLAMTLRTLAHQHEAAVVIANQVSDRIPRDYDAIGLFSLDYQSQWFSGWDDTDPNPKIPSLGLVWTNNISTRLALIKKTDSATNNSGRIFRVVYSPNSPRLDVRICIGSVGIYSC rad54_schpo DNA repair protein rhp54 rhp54 rad54 SPAC15A10.03c RAD54 homolog 1 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MIQQPTTAKPRISTSSKLNTVLSKNKENVPGKLFKKFKCPSLVISEKRKELPLRKKPRVNYSEYGSVDGKYDSAYVSENVSGLATIKEANRLILNHERRDPSTVIKKQFSVPKPIKGHEDISKLCAHRPPPTLGMKRKVDFIPRPLYDPADEFAIVLYDPTTDADEIIPDIKEVLAEKRKKDELLKNRKGKKEISDSEPESDHDSCVSTDTVASCSTEQSLITSNTSKHRRPNKSLKDLLGIQKEKPPPPPVAVVIDPKLARILRPHQIEGVKFLYKCVTGRIDRCANGCIMADEMGLGKTLQCIALLWTLLKQSPQAGKPTIEKAIITCPSSLVKNWANELVKWLGKDAITPFILDGKSSKQELIMALQQWASVHGRQVTRPVLIASYETLRSYVEHLNNAEIGMLLCDEGHRLKNSDSLTFTALDKLNVQRRVILSGTPIQNDLSEYFSLLNFANPGLLGSRQEFRKNYEIPILKGRDADGTEKDKENGDAKLAELAKIVNRFIIRRTNDILSKYLPVKYEHVVFCNLSEFQLSLYKHFITSPEINKILRGTGSQPLKAIGLLKKICNHPDLLNLTEDLEGCEALFPPGFIPRELRGRDRNIDSSLSGKMLVLERMLYQIKQETDDKIVLISNYTSTLDLFEQLCRARGYKALRLDGTMNVNKRQRLVDTFNDPEKDAFVFLLSSKAGGCGINLIGANRLILFDPDWNPAADQQALARVWRDGQKKDCFVYRFIATGTIEEKIFQRQSHKQSLSSCVVDEAQDVERHFSLDNLRQLFQLNDHTVCETHETYKCKRCRDGKQFIRAPAMLYGDTSTWNHFTNPTLDRIEDHLLKREAGKQQVSTVFQYKSH rad51_schpo DNA repair protein rhp51 rhp51 rad51 SPAC644.14c RAD51 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MADTEVEMQVSAADTNNNENGQAQSNYEYDVNVQDEEDEAAAGPMPLQMLEGNGITASDIKKIHEAGYYTVESIAYTPKRQLLLIKGISEAKADKLLGEASKLVPMGFTTATEYHIRRSELITITTGSKQLDTLLQGGVETGSITELFGEFRTGKSQICHTLAVTCQLPIDMGGGEGKCLYIDTEGTFRPVRLLAVADRYGLNGEEVLDNVAYARAYNADHQLELLQQAANMMSESRFSLLVVDSCTALYRTDFSGRGELSARQMHLARFMRTLQRLADEFGIAVVITNQVVAQVDGISFNPDPKKPIGGNILAHSSTTRLSLRKGRGEQRICKIYDSPCLPESEAIFAINSDGVGDPKEIIAPV 9F26EB9FA4F3C2BA rad22_schpo DNA repair and recombination protein rad22 rad22 SPAC30D11.10 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFEQKQHVASEDQGHFNTAYSHEEFNFLQSSLTRKLGPEYVSRRSGPGGFSVSYIESWKAIELANEIFGFNGWSSSIRSINVDFMDENKENGRISLGLSVIVRVTIKDGAYHEDIGYGSIDNCRGKASAFEKCKKEGTTDALKRALRNFGNSLGNCMYDKYYLREVGKMKPPTYHFDSGDLFRKTDPAARESFIKKQKTLNSTRTVNNQPLVNKGEQLAPRRAAELNDEQTREIEMYADEELDNIFVEDDIIAHLAVAEDTAHPAANNHHSEKAGTQINNKDKGSHNSAKPVQRSHTYPVAVPQNTSDSVGNAVTDTSPKTLFDPLKPNTGTPSPKFISARAAAAAEGVVSAPFTNNFNPRLDSPSIRKTSIIDHSKSLPVQRASVLPIIKQSSQTSPVSNNSMIRDSESIINERKENIGLIGVKRSLHDSTTSHNKSDLMRTNSDPQSAMRSRENYDATVDKKAKKG rti1_schpo DNA repair and recombination protein rti1 rti1 SPBC119.14 Rad twenty-two isogene 1 Rad22 homolog protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MGSLPDQSSCEEFTDSQQDKMTKLLAMQLGPEYISRRSGPGGGSVTYLEAWKAIELANEIFGFNGWSSSIQDIHVDYVEETKEKKFNVGISVIVRVTLKDGSFHEDVGYGSIENCRVKALAYEKCKKEGTTDALKRALRNFGSSMGNCLYDKRYIQKILKMAPAQAEFNYDNLLRANKRPYARFAQKVSTPIESHANKSVKLEHKNSIEKKISNVDKPISDLIENDIHESLPALQNPPIQSHSETDLYADEELDSILMHHERPPIPESPRVEEFEELLNQFEGDEKVSVDKIDAHDKMTEAQVVKIPPVQFMNARVAAAENPHIKHEGMAFQLHKKSNSILKSSNIDHNRSMPIRRPSLTSNNSANTFSTK rfa1_schpo Replication factor A protein 1 ssb1 rad11 rpa1 SPBC660.13c Single-stranded DNA-binding protein p68 subunit protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MAERLSVGALRIINTSDASSFPPNPILQVLTVKELNSNPTSGAPKRYRVVLSDSINYAQSMLSTQLNHLVAENKLQKGAFVQLTQFTVNVMKERKILIVLGLNVLTELGVMDKIGNPAGLETVDALRQQQNEQNNASAPRTGISTSTNSFYGNNAAATAPAPPPMMKKPAAPNSLSTIIYPIEGLSPYQNKWTIRARVTNKSEVKHWHNQRGEGKLFSVNLLDESGEIRATGFNDQVDAFYDILQEGSVYYISRCRVNIAKKQYTNVQNEYELMFERDTEIRKAEDQTAVPVAKFSFVSLQEVGDVAKDAVIDVIGVLQNVGPVQQITSRATSRGFDKRDITIVDQTGYEMRVTLWGKTAIEFSVSEESILAFKGVKVNDFQGRSLSMLTSSTMSVDPDIQESHLLKGWYDGQGRGQEFAKHSVISSTLSTTGRSAERKNIAEVQAEHLGMSETPDYFSLKGTIVYIRKKNVSYPACPAADCNKKVFDQGGSWRCEKCNKEYDAPQYRYIITIAVGDHTGQLWLNVFDDVGKLIMHKTADELNDLQENDENAFMNCMAEACYMPYIFQCRAKQDNFKGEMRVRYTVMSINQMDWKEESKRLINFIESAQ 5F2E77A0E12022EA rad55-rad57 Y2H interaction between rad55 and rad57 in Schpo 768100 n/a 768103 unspecified role unspecified role prey prey n/a 768104 unspecified role unspecified role bait bait physical association physical association false false false Figure 1A. rad55-rad57-1 Y2H interaction between rad55 and rad57 in Schpo 768100 n/a 768103 unspecified role unspecified role bait bait n/a 768104 unspecified role unspecified role prey prey physical association physical association false false false Figure 1A. rad51-rad54-1 Y2H interaction between rad51and rad54 in Schpo 768100 n/a 768105 unspecified role unspecified role bait bait n/a 768106 unspecified role unspecified role prey prey physical association physical association false false false Table 1 and Table 2 rad51-rad51-9 Y2H interaction between rad51and rad51 in Schpo 768100 n/a 768106 unspecified role unspecified role bait bait c-terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 768106 unspecified role unspecified role prey prey n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 768123 768121 physical association physical association false false false Table 2. The c-terminus of rad51 (aa 114-365) interacts with full-length rad51 but even stronger with the n-terminus of rad51 (aa 1-117). rad51-rad51-10 Y2H interaction between rad51and rad51 in Schpo 768100 n/a 768106 unspecified role unspecified role bait bait n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 768106 unspecified role unspecified role prey prey c-terminus sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 768128 768126 physical association physical association false false false Table 2. The n-terminus of rad51 (aa 1-117) interacts strongly with both the full-length rad51 and the c-terminus of rad51 (aa 114-365). rad51-rad57-1 Y2H interaction between rad51and rad57 in Schpo 768100 n/a 768104 unspecified role unspecified role prey prey n/a 768106 unspecified role unspecified role bait bait n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 2. The n-terminus of rad51 (aa 1-117) is able to interact (weakly) with full-length rad57. rad51-rad57-2 Y2H interaction between rad51and rad57 in Schpo 768100 n/a 768106 unspecified role unspecified role prey prey n-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 768104 unspecified role unspecified role bait bait physical association physical association false false false Table 2. Rad57 was able to bind to the n-terminus of rad51(aa 1-117) but not the c-terminus of rad51 (aa 114-365) rad51-rad22-1 Y2H interaction between rad51and rad22 in Schpo 768100 n/a 768107 unspecified role unspecified role bait bait n/a 768106 unspecified role unspecified role prey prey c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 1, Table 2. Rad22 was able to interact more strongly with the c-terminus of rad51(aa 114-365) than the full-length rad51. rad51-rti1 Y2H interaction between rad51and rti1 in Schpo 768100 n/a 768108 unspecified role unspecified role bait bait n/a 768106 unspecified role unspecified role prey prey c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 3. rad51-rti1-1 Y2H interaction between rad51and rti1 in Schpo 768100 n/a 768108 unspecified role unspecified role prey prey n/a 768106 unspecified role unspecified role bait bait c-terminus required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Table 3. rti1-rti1-2 Y2H interaction between rti1and rti1 in Schpo 768100 n/a 768108 unspecified role unspecified role prey prey n/a 768108 unspecified role unspecified role bait bait physical association physical association false false false Table 3. There seems to be a weak self-interaction with rti1. rad11-rti1-3 Y2H interaction between rad11and rti1 in Schpo 768100 n/a 768109 unspecified role unspecified role bait bait n/a 768108 unspecified role unspecified role prey prey physical association physical association false false false Table 3. Rad11 interacts strongly with Rti1. rad11-rad22 Y2H interaction between rad11and rad22 in Schpo 768100 n/a 768107 unspecified role unspecified role prey prey n/a 768109 unspecified role unspecified role bait bait physical association physical association false false false Table 3. Rad11 interacts weakly with Rad22. rti1-rad22 Y2H interaction between rti1and rad22 in Schpo 768100 n/a 768107 unspecified role unspecified role bait bait n/a 768108 unspecified role unspecified role prey prey physical association physical association false false false Table 3. Rad22 interacts strongly with Rti1. rad22-rad22 Y2H interaction between rad22 and rad22 in Schpo 768100 n/a 768107 unspecified role unspecified role bait bait n/a 768107 unspecified role unspecified role prey prey physical association physical association false false false Table 3. Rad22 is able to interact with itself. rad55-rad57-2 CoIP showing interaction between rad55 and rad57 in Schpo 768101 n/a 768103 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 768104 unspecified role unspecified role bait bait physical association physical association false false false Figure 1B. rad55-rad57-3 CoIP showing interaction between rad55 and rad57 in Schpo 768102 n/a 768103 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag western blot western blot Immuno blot Immuno blot undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 768104 unspecified role unspecified role prey prey physical association physical association false false false Figure 1C.