IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ hong-2001a-2 A novel UDP-glucose transferase is part of the callose synthase complex and interacts with phragmoplastin at the forming cell plate. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hong Z., Zhang Z., Olson JM., Verma DP. verma.1@osu.edu Arabidopsis cDNA library, made from mRNAs of 6- to 8-day-old seedlings. Plant Cell (1040-4651) 2001 hong-2001a-1 A novel UDP-glucose transferase is part of the callose synthase complex and interacts with phragmoplastin at the forming cell plate. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Hong Z., Zhang Z., Olson JM., Verma DP. verma.1@osu.edu Arabidopsis cDNA library, made from mRNAs of 6- to 8-day-old seedlings. Plant Cell (1040-4651) 2001 u75b1_arath UDP-glycosyltransferase 75B1 UGT75B1 At1g05560 UGT1 IAA-Glu synthase 1 (Uridine 5'-diphosphate-glucose:indol-3-ylacetyl)-beta-D-glucosyl transferase 1 Indole-3-acetate beta-glucosyltransferase 1 T25N20.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAPPHFLLVTFPAQGHVNPSLRFARRLIKRTGARVTFVTCVSVFHNSMIANHNKVENLSFLTFSDGFDDGGISTYEDRQKRSVNLKVNGDKALSDFIEATKNGDSPVTCLIYTILLNWAPKVARRFQLPSALLWIQPALVFNIYYTHFMGNKSVFELPNLSSLEIRDLPSFLTPSNTNKGAYDAFQEMMEFLIKETKPKILINTFDSLEPEALTAFPNIDMVAVGPLLPTEIFSGSTNKSVKDQSSSYTLWLDSKTESSVIYVSFGTMVELSKKQIEELARALIEGKRPFLWVITDKSNRETKTEGEEETEIEKIAGFRHELEEVGMIVSWCSQIEVLSHRAVGCFVTHCGWSSTLESLVLGVPVVAFPMWSDQPTNAKLLEESWKTGVRVRENKDGLVERGEIRRCLEAVMEEKSVELRENAKKWKRLAMEAGREGGSSDKNMEAFVEDICGESLIQNLCEAEEVKVK sdlca_soybn Dynamin-related protein 12A Soybean dynamin-like protein 12A Phragmoplastin protein protein soybn Glycine max (Soybean) Glycine hispida MENLISLVNKIQRACTALGDHGENSALPTLWDSLPAIAVVGGQSSGKSSVLESVVGKDFLPRGSGIVTRRPLVLQLHKIDEGSREYAEFLHLPRKRFTDFVAVRKEIQDETDRETGRTKQISSVPIHLSIYSPNVVNLTLIDLPGLTKVAVEGQPDSIVKDIEDMVRSYIEKPNCIILAISPANQDLATSDAIKISREVDPTGDRTIGVLTKIDLMDKGTDAVDILEGRAYRLKFPWIGVVNRSQQDINKNVDMIAARRREREYFNSTPEYKHLANRMGSEHLAKMLSKHLETVIKSKIPGIQSLINKTIAELEAELTRLGKPVAADAGGKLYAIMEICRSFDQIFKDHLDGVRPGGDKIYNVFDNQLPAALKRLQFDKQLSMENIRKLITEADGYQPHLIAPEQGYRRLIESSLITIRGPAESAVDAVHSLLKDLVHKAMSETLDLKQYPGLRVEVGAASVDSLERMRDESKRATLQLVDMECGYLTVDFFRKLPQDVDKGGNPTHSICDRYNDSYLRRIGTTILSYVNMVCATLRHSIPKSIVYCQVREAKRSLLDHFFTELGKMEIKRLSSLLNEDPAIMERRSALAKRLELYRSAQAEIDAVAWSK rac11_arath Rac-like GTP-binding protein ARAC11 GTPase protein ROP1 ARAC11 ROP1 F24M12.340 At3g51300 RAC11 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKLDLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVLQPPKQKKKKSKAQKACSIL sdl12a-at1g05560-1 Soyabean SDL12A (Phragmoplastin) interacts with At1g05560 (UGT1) 733121 N/A 733123 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) N/A 733124 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false Figure 1B rop1-at1g05560-2 Rop1 interacts with At1g05560 (UGT1) 733121 N/A 733125 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro N/A 733123 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Figure 3B sdl12a-at1g05560 Soyabean SDL12A (Phragmoplastin) interacts with At1g05560 (UGT1) 733122 N/A 733124 unspecified role unspecified role bait bait N/A 733123 unspecified role unspecified role prey prey physical association physical association false false false The authors state that the seauence of the isolated cDNA clone "lacked 600 bp at the 5' terminus". Figure 1A