IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ urao-2000-1 Possible His to Asp phosphorelay signaling in an Arabidopsis two-component system. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Urao T., Miyata S., Yamaguchi-Shinozaki K., Shinozaki K. kazukoys@jircas.affrc.go.jp FEBS Lett. (0014-5793) 2000 ahk1_arath Histidine kinase 1 AHK1 Arabidopsis histidine kinase 1 Protein AUTHENTIC HIS-KINASE 1 T13L16.16 T17A5 At2g17820 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGDSFSMSIENLPDSPMGSRKKKMQIRKVFDKMTEWVTPWRSNLESPREMMILRGDVEQDEFQYASSHCLSSYYSVFVVRLAIMVMLAILIGLLTVLTWHFTRIYTKQSLQTLAYGLRYELLQRPVLRMWSVLNTTSELTTAQVKLSEYVIKKYDKPTTQEELVEMYQAMKDVTWALFASAKALNAITINYRNGFVQAFHRDPASSSTFYIFSDLKNYSISGTGPEDVSGWNNKSIHGNMSAIWYQQQLDPVTGENLGKPLKIPPDDLINIAGISQVPDGEASWHVTVSKYMDSPLLSAALPVFDASNKSIVAVVGVTTALYSVGQLMRDLVEVHGGHIYLTSQEGYLLATSTDGPLLKNTSNGPQLMKATDSEEWVIKSGAQWLEKTYGSKRPHVVHAENVKLGDQRYYIDSFYLNLKRLPIVGVVIIPRKFIMGKVDERAFKTLIILISASVCIFFIGCVCILILTNGVSKEMKLRAELIRQLDARRRAEASSNYKSQFLANMSHELRTPMAAVIGLLDILISDDCLSNEQYATVTQIRKCSTALLRLLNNILDLSKVESGKLVLEEAEFDLGRELEGLVDMFSVQCINHNVETVLDLSDDMPALVRGDSARLVQIFANLISNSIKFTTTGHIILRGWCENINSLHDEMSVSVDRRKPWAPMKTKQVQHRNHLQKSCKNANKMVLWFEVDDTGCGIDPSKWDSVFESFEQADPSTTRTHGGTGLGLCIVRNLVNKMGGEIKVVQKNGLGTLMRLYLILSTPDTVDQNIQPDFSKYGLVVMLSMYGSTARMITSKWLRKHGIATVEASDWNELTQIIRDLLETGSRDNSFDSQHNISDPLRAELSNIVEIKNPVFVIVVDIGVLDLTTNIWKEQLNYLDRFSNKAKFAWLLKHDTSNTVKTELRRKGHVMMVNKPLYKAKMIQILEAVIKNRKRGLCNDLRNRGNGSDESHDCLEIDPTQFDTCSSDDSSETSGEKQVDKSVKPSTLHSPVLKNYLIDATTSNDDSTSASMTQKNPEEEDWKDRLYSGIALDGKNQKSLEGIRILLAEDTPVLQRVATIMLEKMGATVTAVWDGQQAVDSLNYKSINAQAPTEEHKSFEEETANKVTTRETSLRNSSPYDLILMDCQMPKMDGYEATKAIRRAEIGTELHIPIVALTAHAMSSDEAKCLEVGMDAYLTKPIDRKLMVSTILSLTKPSAFQTSLSA ahp2_arath Histidine-containing phosphotransfer protein 2 AHP2 ATHP1 At3g29350 MUO10.6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDALIAQLQRQFRDYTISLYQQGFLDDQFTELKKLQDDGSPDFVSEVLSLFFEDCVKLISNMARALDTTGTVDFSQVGASVHQLKGSSSSVGAKRVKTLCVSFKECCEAKNYEGCVRCLQQVDIEYKALKTKLQDMFNLEKQIIQAGGIVPQVDIN etr1_arath Ethylene receptor 1 ETR1 T27F4.9 At1g66340 Protein ETHYLENE RESPONSE 1 Protein ETR1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVCNCIEPQWPADELLMKYQYISDFFIAIAYFSIPLELIYFVKKSAVFPYRWVLVQFGAFIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTRELFLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECALWMPTRTGLELQLSYTLRHQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSGKYMLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVADQVAVALSHAAILEESMRARDLLMEQNVALDLARREAETAIRARNDFLAVMNHEMRTPMHAIIALSSLLQETELTPEQRLMVETILKSSNLLATLMNDVLDLSRLEDGSLQLELGTFNLHTLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSISVTALVTKSDTRAADFFVVPTGSHFYLRVKVKDSGAGINPQDIPKIFTKFAQTQSLATRSSGGSGLGLAISKRFVNLMEGNIWIESDGLGKGCTAIFDVKLGISERSNESKQSGIPKVPAIPRHSNFTGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHKVVFMDVCMPGVENYQIALRIHEKFTKQRHQRPLLVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEPRVLYEGM ahp3_arath Histidine-containing phosphotransfer protein 3 AHP3 ATHP2 At5g39340 MUL8.2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDTLIAQLQRRFCDFTISLYHQGFLDDQFTELKKLQDECSPDFVAEVVTLFFEDCEKLISNMARALDQTGNVDFKLVGSSVHQLKGSSSSVGAKRVKGLCVTLKECCDSQNYEGCVRCLQQVDIEYKTLKAKLQDLFNLEQQIVQAGGRIPQVDI ahp1_arath Histidine-containing phosphotransfer protein 1 AHP1 ATHP3 At3g21510 MIL23.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDLVQKQKSLQDYTKSLFLEGILDSQFLQLQQLQDESNPDFVSQVVTLFFQDSDRILNDLSLSLDQQVVDFKKVDPHVHQLKGSSSSIGAQRVKNACVVFRSFCEQQNVEACHRCLQQVKQEYYLVKNRLETLFKLEQQIVASGGMIPAVELGF cki1_arath Histidine kinase CKI1 CKI1 At2g47430 Protein CYTOKININ-INDEPENDENT 1 T30B22.27 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMVKVTKLVASRPIVVFCVLAFLVVVFECIWISNWRTTTENLVKEVASFTEDLRTSLVSEIENIGKFTYAKTNLSTIGLARVIDSYITNNDTGFTEIQTQIAPLLFVAYSTILQVSQVSYISRDGLMFSYIAESNTSVAVFANSSSNSSRGDYTWYTQTVDQLTGRLNGNSTKSQSLDVTHTDWFQAAQSNNYTTAFVGTSLGGEDNETLIQSVVSLYSKKGLVSLGFPVKTLTEVLNSLNLHGEELYMWTKDGTVLVREGSLNDSFFISNGSICFGRESNSLWSQCIPENCSSSGYEVEIKRLRYQAFCSVIEVSGVPLRYTLMFPNKGGATRIKHQAEKAKYQLIVVMIFLGFGWPVWFVWFMMQATRREMHMRATLINQMEATQQAERKSMNKSQAFANASHDIRGALAGMKGLIDICRDGVKPGSDVDTTLNQVNVCAKDLVALLNSVLDMSKIESGKMQLVEEDFNLSKLLEDVIDFYHPVAMKKGVDVVLDPHDGSVFKFSNVRGDSGRLKQILNNLVSNAVKFTVDGHIAVRAWAQRPGSNSSVVLASYPKGVSKFVKSMFCKNKEESSTYETEISNSIRNNANTMEFVFEVDDTGKGIPMEMRKSVFENYVQVRETAQGHQGTGLGLGIVQSLVRLMGGEIRITDKAMGEKGTCFQFNVLLTTLESPPVSDMKVRQEIEAGGDYVSTPNLGLTINTSLGGSMNIRNLSPRFNNCLSSSPKQEGSRVVLLLKNEERRRVTEKYIKNLGIKVTVVEKWEHLSYALERLFGFSPQSSMGRAECSLSCPSSRELPFIGMDGIDSRSQLPKRRSISFSAVVLLVIDAKTGPFFELCDIVKQFRRGLPHGISCKVVWLNESSTRVSERGDISCSRPLHGSRLMEVLKMLPEFGGTVLKEPPTELQRESLLRHSFVAERSPKHKVQEEGPSSMFNKKLGKRIMASTDSESETRVKSVRTGRKPIGNPEDEQETSKPSDDEFLRGKRVLVVDDNFISRKVATGKLKKMGVSEVEQCDSGKEALRLVTEGLTQREEQGSVDKLPFDYIFMDCQMPEMDGYEATREIRKVEKSYGVRTPIIAVSGHDPGSEEARETIQAGMDAFLDKSLNQLANVIREIESKRH sln1_yeast Osmosensing histidine protein kinase SLN1 YIL147C SLN1 YPD2 Osmolarity two-component system protein SLN1 Tyrosine phosphatase-dependent protein 2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MRFGLPSKLELTPPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSSFNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHFVFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVNWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELITEGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVSGHGGSGHGSGAAFSANSSMKSAINLGNEKMSPPEEENKIPNNHTDAKISMDGSLNHDLLGPHSLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNEQNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTVKDDDKNETSVKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAAYQGKKNNK 45FFE24A8165486B arr9_arath Two-component response regulator ARR9 ARR9 ATRR4 At3g57040 F24I3.120 Response reactor 4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGMAAESQFHVLAVDDSLFDRKLIERLLQKSSCQVTTVDSGSKALEFLGLRQSTDSNDPNAFSKAPVNHQVVEVNLIITDYCMPGMTGYDLLKKVKESSAFRDIPVVIMSSENVPARISRCLEEGAEEFFLKPVRLADLNKLKPHMMKTKLKNQKLEEIETTSKVENGVPTAVADPEIKDSTNIEIEILPLQQDLLLVQQEEQTLSINNKRKSVEEGISTDRARPRFDGIATAV arr4_arath Two-component response regulator ARR4 Response regulator 1 ARR4 ATRR1 IBC7 At1g10470 T10O24.8 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MARDGGVSCLRRSEMMSVGGIGGIESAPLDLDEVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDNEKASAEFDRLKVDLIITDYCMPGMTGYELLKKIKESSNFREVPVVIMSSENVLTRIDRCLEEGAQDFLLKPVKLADVKRLRSHLTKDVKLSNGNKRKLPEDSSSVNSSLPPPSPPLTISPESSPPLTVSTESSDSSPPLSPVEIFSTSPLSSPIDDEDDDVLTSSSEESPIRRQKMRSPGLD arr3_arath Two-component response regulator ARR3 ARR3 F23H11.25 At1g59940 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKDGGVSCLRRSEMIGIGIGELESPPLDSDQVHVLAVDDSLVDRIVIERLLRITSCKVTAVDSGWRALEFLGLDDDKAAVEFDRLKVDLIITDYCMPGMTGYELLKKIKESTSFKEVPVVIMSSENVMTRIDRCLEEGAEDFLLKPVKLADVKRLRSYLTRDVKVAAEGNKRKLTTPPPPPPLSATSSMESSDSTVESPLSMVDDEDSLTMSPESATSLVDSPMRSPGLA ahp2-at2g17820 AHP2 (ATHP1) interacts with ATHK1 (At2g17820) 744135 N/A 744136 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9SXL4:p.Asp1075Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false N/A 744137 unspecified role unspecified role bait bait physical association physical association false false false Figure 1 The authors state that "to construct expression plasmids ATHK1-RD and ATHK1-RD (D1074E), the receiver domain of ATHK1 (amino acids 961-1207) was amplifed by PCR". However the Uniprot record for this protein is only 1190 amino acids in length and appears to be missing a 17 amino acid sequence at its n-termini (MRGDSFSMSIENLPDSP). The region used in the yeast two hybrid consists of a c-terminal 246 amino acid region, the coordinates for this region are taken from the Uniprot record and differ from that presented by the authors. The authors concluded "these results suggest that the interaction between ATHK1 and ATHP1 depends on the phosphorylation state of the receiver domain of ATHK1". at2g17820-ahp2 ATHK1 (At2g17820) interacts with AHP2 (ATHP1) 744135 N/A 744137 unspecified role unspecified role prey prey N/A 744136 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9SXL4:p.Asp1075Glu mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 The authors state that "to construct expression plasmids ATHK1-RD and ATHK1-RD (D1074E), the receiver domain of ATHK1 (amino acids 961-1207) was amplifed by PCR". However the Uniprot record for this protein is only 1190 amino acids in length and appears to be missing a 17 amino acid sequence at its n-termini (MRGDSFSMSIENLPDSP). The region used in the yeast two hybrid consists of a c-terminal 246 amino acid region, the coordinates for this region are taken from the Uniprot record and differ from that presented by the authors. The authors concluded "these results suggest that the interaction between ATHK1 and ATHP1 depends on the phosphorylation state of the receiver domain of ATHK1". ahp2-etr1 AHP2 (ATHP1) interacts with ETR1 744135 N/A 744137 unspecified role unspecified role bait bait N/A 744138 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 etr1-ahp2 ETR1 interacts with AHP2 (ATHP1) 744135 N/A 744137 unspecified role unspecified role prey prey N/A 744138 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 ahp3-etr1 AHP3 (ATHP2) interacts with ETR1 744135 N/A 744138 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744139 unspecified role unspecified role bait bait physical association physical association false false false Figure 2 etr1-ahp3 ETR1 interacts with AHP3 (ATHP2) 744135 N/A 744138 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744139 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 ahp1-etr1-1 AHP1 (ATHP3) interacts with ETR1 744135 N/A 744140 unspecified role unspecified role bait bait N/A 744138 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 etr1-ahp1 ETR1 interacts with AHP1 (ATHP3) 744135 N/A 744140 unspecified role unspecified role bait bait N/A 744138 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 ahp2-cki1 AHP2 (ATHP1) interacts with CKI1 744135 N/A 744141 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744137 unspecified role unspecified role bait bait physical association physical association false false false Figure 2 cki1-ahp2 CKI1 interacts with AHP2 (ATHP1) 744135 N/A 744141 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744137 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 ahp3-cki1 AHP3 (ATHP2) interacts with CKI1 744135 N/A 744139 unspecified role unspecified role bait bait N/A 744141 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 cki1-ahp3 CKI1 interacts with AHP3 (ATHP2) 744135 N/A 744139 unspecified role unspecified role prey prey N/A 744141 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 ahp2-sln1 AHP2 (ATHP1) interacts with SLN1 744135 N/A 744142 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744137 unspecified role unspecified role bait bait physical association physical association false false false Figure 2 sln1-ahp2 SLN1 interacts with AHP2 (ATHP1) 744135 N/A 744142 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744137 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 ahp1-sln1 AHP1 (ATHP3) interacts with SLN1 744135 N/A 744140 unspecified role unspecified role bait bait N/A 744142 unspecified role unspecified role prey prey c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 sln1-ahp1 SLN1 interacts with AHP1 (ATHP3) 744135 N/A 744140 unspecified role unspecified role prey prey N/A 744142 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 2 ahp3-arr9 AHP3 (ATHP2) interacts with ARR9 (ATRR4) 744135 N/A 744143 unspecified role unspecified role prey prey N/A 744139 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 arr9-ahp3-1 ARR9 (ATRR4) interacts with AHP3 (ATHP2) 744135 N/A 744143 unspecified role unspecified role bait bait N/A 744139 unspecified role unspecified role prey prey physical association physical association false false false Figure 3 ahp1-arr9 AHP1 (ATHP3) interacts with ARR9 (ATRR4) 744135 N/A 744143 unspecified role unspecified role prey prey N/A 744140 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 arr9-ahp1-1 ARR9 (ATRR4) interacts with AHP1 (ATHP3) 744135 N/A 744140 unspecified role unspecified role prey prey N/A 744143 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 ahp1-arr4 AHP1 (ATHP3) interacts with ARR4 (ATRR1) 744135 N/A 744144 unspecified role unspecified role prey prey N/A 744140 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 arr4-ahp1-1 ARR4 (ATRR1) interacts with AHP1 (ATHP3) 744135 N/A 744140 unspecified role unspecified role prey prey N/A 744144 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 sln1-ahp3 SLN1 interacts with AHP3 (ATHP2) 744135 N/A 744142 unspecified role unspecified role bait bait c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false N/A 744139 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 ahp2-arr9 AHP2 (ATHP1) interacts with ARR9 (ATRR4) 744135 N/A 744137 unspecified role unspecified role bait bait N/A 744143 unspecified role unspecified role prey prey physical association physical association false false false Figure 3A ahp3-arr3-1 AHP3 (ATHP2) interacts with ARR3 744135 N/A 744145 unspecified role unspecified role prey prey N/A 744139 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 ahp1-arr3-2 AHP1 (ATHP3) interacts with ARR3 744135 N/A 744145 unspecified role unspecified role prey prey N/A 744140 unspecified role unspecified role bait bait physical association physical association false false false Figure 3