UniProt UniProt http://www.uniprot.org ruggiu-2000-1 In vivo and in vitro analysis of homodimerisation activity of the mouse Dazl1 protein. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Ruggiu M., Cooke HJ. howard@hgu.mrc.ac.uk Gene (0378-1119) 2000 Only protein-protein interactions imex curation ruggiu-2000-2 In vivo and in vitro analysis of homodimerisation activity of the mouse Dazl1 protein. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Ruggiu M., Cooke HJ. howard@hgu.mrc.ac.uk Gene (0378-1119) 2000 Only protein-protein interactions imex curation dazl_mouse Deleted in azoospermia-like Dazl Dazl1 Dazla DAZ-like autosomal Deleted in azoospermia-like 1 protein protein mouse Mus musculus Mouse MSATTSEAPNSAVSREASTQSSSATTSQGYVLPEGKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIRKQNLCTYHVQPRPLIFNPPPPPQFQSVWSSPNAETYMQPPTMMNPITQYVQAYPPYPSSPVQVITGYQLPVYNYQMPPQWPAGEQRSYVIPPAYTTVNYHCSEVDPGADILPNECSVHDAAPASGNGPQKKSVDRSIQTVVSCLFNPENRLRNSLVTQDDYFKDKRVHHFRRSRAVLKSDHLC daz1_human Deleted in azoospermia protein 1 DAZ1 DAZ SPGY protein protein human Homo sapiens Human MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVKIITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQNVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD dazl-dazl 771492 n/a 771494 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 771494 unspecified role unspecified role bait bait region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 771500 771498 physical association physical association false false false 1 Dazl (full length) mutation constructs phe-32 asp, tyr82asp, phe84asp and phe87asp also interact. dazl-daz1 771492 n/a 771494 unspecified role unspecified role prey prey n/a 771495 unspecified role unspecified role bait bait physical association physical association false false false 1 dazl-dazl-1 771493 n/a 771494 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region t7 tag t7 tag MASMTGGQQMG epitope tag MASMTGGQQMG epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 771494 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false 2