IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ bischoff-2000-1 Localization of AtROP4 and AtROP6 and interaction with the guanine nucleotide dissociation inhibitor AtRhoGDI1 from Arabidopsis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bischoff F., Vahlkamp L., Molendijk A., Palme K. Plant Mol. Biol. (0167-4412) 2000 bischoff-2000-2 Localization of AtROP4 and AtROP6 and interaction with the guanine nucleotide dissociation inhibitor AtRhoGDI1 from Arabidopsis. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Bischoff F., Vahlkamp L., Molendijk A., Palme K. Plant Mol. Biol. (0167-4412) 2000 gdir_arath Rho GDP-dissociation inhibitor 1 GDI1 F17A17.22 At3g07880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLVSGARDMGFDDNNNNKNNKDGDDENSSSRTRADDDALSRQMSESSLCATEEEEDDDSKLQLGPQYTIKEHLEKDKDDESLRKWKEQLLGSVDVTNIGETLDPEVRIDSLAIISPGRPDIVLLVPENGNPKGMWFTLKEGSKYNLKFTFHVNNNIVSGLRYTNTVWKTGVKVDRAKEMLGTFSPQLEPYNHVMPEETTPSGMFARGSYSARTKFLDDDNKCYLEINYSFDIRKEWPAL rac5_arath Rac-like GTP-binding protein ARAC5 ARAC5 ATGP3 ROP4 T4O12.8 At1g75840 GTPase protein ROP4 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVLQPPKQKKKKKNKNRCVFL rac3_arath Rac-like GTP-binding protein ARAC3 ARAC3 RAC1 ROP6 M4E13.80 At4g35020 GTPase protein ROP6 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKLDLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVLQPPKNKKKKKRKSQKGCSIL arac5-gdi1 ARAC5 (Rop4) protein interacts with GDI1 (RhoGD1) protein 732672 N/A 732674 unspecified role unspecified role prey prey N/A 732675 unspecified role unspecified role bait bait Q38937:p.Thr20Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7 arac3-gdi1 ARAC3 (Rop6) protein interacts with GDI1 (RhoGD1) protein 732672 N/A 732674 unspecified role unspecified role prey prey N/A 732676 unspecified role unspecified role bait bait Q38912:p.Thr20Asn mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 7 gdi1-arac5 ARAC5 (Rop4) protein interacts with GDI1 (RhoGD1) protein 732673 N/A 732675 unspecified role unspecified role prey prey n-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false tobac-by_2 Tobacco cell line by_2 Tobacco cell line An undifferentiated cell line derived from tobacco callus tissue. An undifferentiated cell line derived from tobacco callus tissue. N/A 732674 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Figure 8