UniProt UniProt http://www.uniprot.org reynolds-2000-2 Essential interaction between the fission yeast DNA polymerase delta subunit Cdc27 and Pcn1 (PCNA) mediated through a C-terminal p21(Cip1)-like PCNA binding motif. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Reynolds N., Warbrick E., Fantes PA., MacNeill SA. s.a.macneill@ed.ac.uk S.pombe cDNA EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation reynolds-2000-4 Essential interaction between the fission yeast DNA polymerase delta subunit Cdc27 and Pcn1 (PCNA) mediated through a C-terminal p21(Cip1)-like PCNA binding motif. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Reynolds N., Warbrick E., Fantes PA., MacNeill SA. s.a.macneill@ed.ac.uk S.pombe cDNA EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation reynolds-2000-1 Essential interaction between the fission yeast DNA polymerase delta subunit Cdc27 and Pcn1 (PCNA) mediated through a C-terminal p21(Cip1)-like PCNA binding motif. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Reynolds N., Warbrick E., Fantes PA., MacNeill SA. s.a.macneill@ed.ac.uk S.pombe cDNA EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation reynolds-2000-5 Essential interaction between the fission yeast DNA polymerase delta subunit Cdc27 and Pcn1 (PCNA) mediated through a C-terminal p21(Cip1)-like PCNA binding motif. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Reynolds N., Warbrick E., Fantes PA., MacNeill SA. s.a.macneill@ed.ac.uk S.pombe cDNA EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation reynolds-2000-3 Essential interaction between the fission yeast DNA polymerase delta subunit Cdc27 and Pcn1 (PCNA) mediated through a C-terminal p21(Cip1)-like PCNA binding motif. schpm Schizosaccharomyces pombe (fission yeast) Fission yeast pull down pull down anti tag western anti tag western blot anti tag western Reynolds N., Warbrick E., Fantes PA., MacNeill SA. Tagged versions of the proteins have been expressed in S.pombe. s.a.macneill@ed.ac.uk S.pombe cDNA EMBO J. (0261-4189) 2000 Only protein-protein interactions imex curation pcna_schpo Proliferating cell nuclear antigen pcn1 pcn SPBC16D10.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MLEARFQQAALLKKLLDAIKELVTDANFDCNDNGISLQAMDSSHVALVSMLIKSDGFEPYRCDRNIALGINLNALSKVLRCAQNEDLVTLKAEDTPEVLNLVFESEKNDRISDYDVKLMDIDQEHLGIPDIEYDATITMPAAEFQRITRDLLTLSDSVTINASKEGVRFSCKGDIGNGSTTLKQHTDLSDQDQSIEISLTQAVTLTFSLKYLAQFTKATPLATRVTLSMSNDVPLLVEYKMESGFLRFYLAPKIGEEDEE 1EE5B2A27A899C4E dpod3_schpo DNA polymerase delta subunit 3 Cell division control protein 27 cdc27 SPBC1734.02c SPBC337.18c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEEWRNFLDIKVINESSLVTVDNLSLQLDISSEKAQEYLNMFYQGNDFLYPIYLIHGQPIDDEINLEIDEESQPISNFPVLQYILCDKSSLQEKQSRLKSGYKTVIFALSSAPLSDFDELLPAVYEIREKDVLYKKEDADKYGFIFNENSVPRVLKKAPSTHSPQLSVPSKTSTIDKTDTRSTEKTKGKDIFSNARNQKGNSSRKNKKAPLENHKEKEPLLPKEEKLSEQAKRERDDLKNIMQLEDESVSTTSVHDSEDDNLDSNNFQLEIGTEAKSAAPDEPQEIIKSVSGGKRRGKRKVKKYATTKDEEGFLVTKEEEVWESFSEDENISTGTSNVVRNKPTTVNIATKKKNTAQSKPQQKSIMSFFGKK dpod2_schpo DNA polymerase subunit delta-2 cdc1 SPAC27E2.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MVEVRHSIPCEETKRLELSLSQQTYSQQYASIYFARLTALRPRITEAASKKWPDKQRLERVLDVKSDEDCWVVATAYMTTALKPNVMNDVTQLHTIVTTTEESPYVSPEDAASGDIEYALEDDYGRIDCSGSFLYDAGVVTGVVLAVLGHEDEQGRFVVVDVCFPGIFSHSIPMTTDESQAQPEYIAAVSGLGLSNDGIEGIQVHQLVDFLRGTLPHVSSFSPSSIKRLIILGNCLAPSIEIADSASASVPIGKKKVKRYGYDTSAYNPNPTFQLDNFLDQVCSSIDVTLMPGPYDYSSTILPQQPLHPALLTKSKVWLGSSLQTVTNPTWLSLGNHFVLATSGQNINDLRKYHPKKSSLQCMENTLLWNHITPTSPDTLWCYPFTDKDTFVMEEMPDLYLCGNQPKFGCKTVINEGNRIQLVSVPEFRKTGVLVLINMHTLNVEIIQFRPMSVKAETPITS cdn1a_human Cyclin-dependent kinase inhibitor 1 CDKN1A CAP20 CDKN1 CIP1 MDA6 PIC1 SDI1 WAF1 p21 CDK-interacting protein 1 Melanoma differentiation-associated protein 6 protein protein human Homo sapiens Human MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP dpod3_yeast DNA polymerase delta subunit 3 POL32 J1626 YJR043C protein protein yeast Saccharomyces cerevisiae Baker's yeast MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNAKYNCVVICCYKDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDIIDQKDCLTIKNSYELKVSESSKIIERTKTLEEKSKPLVRPTARSKTTPEETTGRKSKSKDMGLRSTALLAKMKKDRDDKETSRQNELRKRKEENLQKINKQNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDSNDKDKNNDDLEDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVTKRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK D0B9CC52F26E20B2 cdc27-pcn1 774369 n/a 774374 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 774375 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false 1B-D GST-cdc27 constructs with a mutation of Gln-362 to Ala, Val, Asp, Glu, Asn or Lys also interact. pcn1-cdc27-1 774369 n/a 774375 unspecified role unspecified role prey prey region biotinylated fusion protein n6btnlys N6-biotinyl-L-lysine (2S)-2-amino-6-(5-[(3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanoylamino)hexanoic acid (3aS-(3aalpha,4beta,6aalpha))-N6-(5-(hexahydro-2-oxo-1H-thieno(3,4-d)imidazol-4-yl)-1-oxopentyl)-L-lysine MOD_RES N6-biotinyllysine N6-[5-((3aS,4S,6aR)-hexahydro-2-oxo-1H-thieno[3,4-d]imidazol-4-yl)-1-oxopentyl]-L-lysine N6-biotinyl-L-lysine N6-biotinyllysine biocytin epsilon-N-biotinyllysine Biotin Biotinylation N6BtnLys biotinyl lysyl certain certain sequence position certain certain certain sequence position certain false region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 774374 unspecified role unspecified role bait bait in vitro In vitro physical association physical association false false false 4 cdc27-cdc1 774369 n/a 774376 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 774375 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false 7C cdc27-pcn1-1 774370 n/a 774374 unspecified role unspecified role prey prey n/a 774375 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false cdc27 synthetic peptide of 20 aa (corresponding to c-terminus of native protein) has been used. 5 a cdc27 peptide bearing a corresponding glu362ala mutation also interacts. CDKN1A/p21, suggesting that cdc27 and CDKN1A share a common binding site on pcn1 p21-pcn1-2 774370 n/a 774374 unspecified role unspecified role prey prey n/a 774377 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false CDKN1A/p21 synthetic peptide of 20 aa (corresponding to c-terminus of native protein) has been used. 5 a CDKN1A/p21 peptide bearing a corresponding glu144ala mutation also interacts. pol32-pcn1-3 774370 n/a 774374 unspecified role unspecified role prey prey n/a 774378 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association false false false Pol32 synthetic peptide of 20 aa (corresponding to c-terminus of native protein) has been used. 5 a Pol32 peptide bearing a corresponding glu338ala mutation also interacts. CDKN1A/p21, suggesting that Pol32 and CDKN1A share a common binding site on pcn1 pcn1-pcn1 774371 n/a 774374 unspecified role unspecified role prey prey n/a 774374 unspecified role unspecified role bait bait physical association physical association false false false pcn1-cdc27 774371 n/a 774374 unspecified role unspecified role bait bait n/a 774375 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 1A cdc1-cdc27-pcn1 774372 n/a 774376 unspecified role unspecified role bait bait n/a 774375 unspecified role unspecified role ancillary ancillary n/a 774374 unspecified role unspecified role prey prey physical association physical association false false false Co-expressed cdc27 was necessary to activate LacZ expresion suggesting that it bridges the Gal4-Pcn1 and LexA-Cdcd1 fusion proteins. 7A cdc1-cdc27 774372 n/a 774376 unspecified role unspecified role bait bait n/a 774375 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 7B pnc1-cdc27 774373 n/a 774375 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 774374 unspecified role unspecified role bait bait n-terminus MRGS(His6) tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Q03392; P30261 transformation 2